Skip to Content
Merck
All Photos(4)

Documents

SAB1403322

Sigma-Aldrich

Monoclonal Anti-KIAA1199 antibody produced in mouse

clone 3C12, purified immunoglobulin, buffered aqueous solution

Synonym(s):

TMEM2L

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

3C12, monoclonal

form

buffered aqueous solution

mol wt

antigen ~37.11 kDa

species reactivity

human

technique(s)

capture ELISA: suitable
immunoprecipitation (IP): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

NCBI accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

General description

KIAA1199 is an endonuclear protein secreted into the extracellular environment. It encodes a 150kDa, inner ear-specific protein consisting of three domains and an N-terminal secretion signal. It is expressed in the inner ear.
Mouse monoclonal antibody raised against a partial recombinant KIAA1199.

Immunogen

KIAA1199 (NP_061159.1, 880 a.a. ~ 979 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LYDGPINIQNCTFRKFVALEGRHTSALAFRLNNAWQSCPHNNVTGIAFEDVPITSRVFFGEPGPWFNQLDMDGDKTSVFHDVDGSVSEYPGSYLTKNDNW

Application

Monoclonal Anti-KIAA1199 antibody produced in mouse is suitable for capture ELISA, indirect ELISA and western blot applications.

Biochem/physiol Actions

KIAA1199 performs in cell signaling, adhesion, migration and proliferation in human cancers. In colon cancer, it is highly expressed in several cells including cytoplasm, perinuclear space and the cell membrane of adenocarcinomas and cochlea. It mediates hyaluronan (HA) depolymerization in an acidic cellular microenvironment such as clathrin-coated vesicles or early endosomes. In addition, it is also associated with the protein binding, transport, and folding; and Ca2+, G-protein, ephrin, and Wnt signaling. It has been reported that KIAA1199 may negatively regulate the Wnt/CTNNB1 signaling pathway.

Physical form

Solution in phosphate buffered saline, pH 7.4

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Yongsheng Zhang et al.
Oncology reports, 31(4), 1503-1508 (2014-02-28)
KIAA1199 is a gene included in the Human Unidentified Gene-Encoded (HUGE) large protein database which contains more than 2,400 members identified in the Kazusa cDNA sequencing project. Early studies described KIAA1199 as an inner ear-specific protein in which 3 point
Amit Tiwari et al.
PloS one, 8(7), e69473-e69473 (2013-08-13)
We previously reported that the expression of KIAA1199 in human colorectal tumors (benign and malignant) is markedly higher than that in the normal colonic mucosa. In this study, we investigated the functions of the protein encoded by this gene, which
Hiroyuki Yoshida et al.
FEBS letters, 588(1), 111-116 (2013-11-26)
Recently, we disclosed that KIAA1199-mediated hyaluronan (HA) depolymerization requires an acidic cellular microenvironment (e.g. clathrin-coated vesicles or early endosomes), but no information about the structural basis underlying the cellular targeting and functional modification of KIAA1199 was available. Here, we show

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service