Skip to Content
Merck
All Photos(5)

Key Documents

HPA017051

Sigma-Aldrich

Anti-DNAJB11 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-DnaJ homolog subfamily B member 11 precursor antibody produced in rabbit, Anti-ER-associated Hsp40 co-chaperone antibody produced in rabbit, Anti-ER-associated dnaJ protein 3 antibody produced in rabbit, Anti-ErJ3 antibody produced in rabbit, Anti-PWP1-interacting protein 4 antibody produced in rabbit, Anti-hDj9 antibody produced in rabbit

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

recombinant expression
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:20-1:50

immunogen sequence

DSEKRKQYDTYGEEGLKDGHQSSHGDIFSHFFGDFGFMFGGTPRQQDRNIPRGSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCDECPNVKLVNEERTLEV

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... DNAJB11(51726)

Looking for similar products? Visit Product Comparison Guide

General description

DNAJB11 (DnaJ (Hsp40) homolog, subfamily B, member 11) is a chaperone of the endoplasmic reticulum belonging to the endoplasmic reticulum (ER) Hsp40/DnaJ family. It is a component of quality control system of ER-associated degradation (ERAD). It contains the J domain, which is a highly conserved region made of 75 amino acids. It also shares certain domains with other HSP40 chaperones. These domains include a C-terminal domain, a glycine/phenylalanine-rich putative linker region and a cystine-rich domain. DNAJB11 is expressed ubiquitously, and has the highest expression in secretory tissues.

Immunogen

DnaJ homolog subfamily B member 11 precursor recombinant protein epitope signature tag (PrEST)

Application

Anti-DNAJB11 antibody is suitable for immunoprecipitation.
Anti-DNAJB11 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

DNAJB11 (DnaJ (Hsp40) homolog, subfamily B, member 11) is a component of unassembled immunoglobulin (Ig) heavy chain: BiP (binding immunoglobulin protein) complex, where it acts as a co-factor for BiP, and helps in folding and assembly of proteins. It plays a major role in mammalian cell resistance to vero toxin. It is also involved in ER (endoplasmic reticulum) stress tolerance. It is secreted in the extracellular space, where it binds to mis-folded proteins and prevents their aggregation. It also reduces the toxicity of disease-related prion protein. DNAJB11 is involved in the intoxication pathway of cholera toxin.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST71693

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Wen-Li Lu et al.
Evidence-based complementary and alternative medicine : eCAM, 2014, 192749-192749 (2014-11-13)
Akebia Fructus has long been used for hepatocellular carcinoma (HCC) in China, while the molecular mechanism remains obscure. Our recent work found that Akebia trifoliate (Thunb.) Koidz seed extract (ATSE) suppressed proliferation and induced endoplasmic reticulum (ER) stress in SMMC-7721.
M Yu et al.
The Journal of biological chemistry, 275(32), 24984-24992 (2000-05-29)
Hsp40 co-chaperones, characterized by the presence of a highly conserved J domain, are involved in nearly all aspects of protein synthesis, folding, and secretion. Within the lumen of the endoplasmic reticulum, these chaperones are also involved in reverse translocation and
Joseph C Genereux et al.
The EMBO journal, 34(1), 4-19 (2014-11-02)
The Unfolded Protein Response (UPR) indirectly regulates extracellular proteostasis through transcriptional remodeling of endoplasmic reticulum (ER) proteostasis pathways. This remodeling attenuates secretion of misfolded, aggregation-prone proteins during ER stress. Through these activities, the UPR has a critical role in preventing
Shane Massey et al.
Infection and immunity, 79(11), 4739-4747 (2011-08-17)
Cholera toxin (CT) is endocytosed and transported by vesicle carriers to the endoplasmic reticulum (ER). The catalytic CTA1 subunit then crosses the ER membrane and enters the cytosol, where it interacts with its Gsα target. The CTA1 membrane transversal involves
Ying Shen et al.
Molecular biology of the cell, 16(1), 40-50 (2004-11-05)
We recently identified ERdj3 as a component of unassembled immunoglobulin (Ig) heavy chain:BiP complexes. ERdj3 also associates with a number of other protein substrates, including unfolded light chains, a nonsecreted Ig light chain mutant, and the VSV-G ts045 mutant at

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service