Skip to Content
Merck
All Photos(1)

Documents

AV45360

Sigma-Aldrich

Anti-PTPN1 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-PTP1B, Anti-Protein tyrosine phosphatase, non-receptor type 1

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

50 kDa

species reactivity

horse, mouse, dog, bovine, rat, guinea pig, human

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... PTPN1(5770)

Related Categories

Immunogen

Synthetic peptide directed towards the middle region of human PTPN1

Application

Anti-PTPN1 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/ml.

Biochem/physiol Actions

Protein tyrosine phosphatase, non-receptor type 1 (PTPN1) is the first member of protein tyrosine phosphatase (PTP) family to be identified. The members of this family are involved in cell growth, differentiation and mitosis. PTPN1 dephosphorylates insulin receptor, JAK2 and TYK2 kinases and negatively regulates cell signaling mediated by these proteins.

Sequence

Synthetic peptide located within the following region: SGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVL

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Edyta E Wojtowicz et al.
Cell stem cell, 19(3), 383-396 (2016-07-19)
Umbilical cord blood (CB) is a convenient and broadly used source of hematopoietic stem cells (HSCs) for allogeneic stem cell transplantation. However, limiting numbers of HSCs remain a major constraint for its clinical application. Although one feasible option would be
Reza Meshkani et al.
Clinical chemistry, 53(9), 1585-1592 (2007-07-20)
Protein tyrosine phosphatase 1B (PTPN1) dephosphorylates insulin receptors and attenuates insulin signaling. Polymorphisms in the coding sequence of PTPN1 have been variably associated with type 2 diabetes (T2D). We hypothesized that variations within the PTPN1 promoter might contribute to the
M P Myers et al.
The Journal of biological chemistry, 276(51), 47771-47774 (2001-11-06)
The reversible tyrosine phosphorylation of proteins, modulated by the coordinated actions of protein-tyrosine kinases and protein-tyrosine phosphatases (PTPs), regulates the cellular response to a wide variety of stimuli. It is established that protein kinases possess discrete sets of substrates and
Tony Tiganis et al.
The Biochemical journal, 402(1), 1-15 (2007-01-24)
It is now well established that the members of the PTP (protein tyrosine phosphatase) superfamily play critical roles in fundamental biological processes. Although there has been much progress in defining the function of PTPs, the task of identifying substrates for

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service