Skip to Content
Merck
All Photos(1)

Key Documents

AV39473

Sigma-Aldrich

Anti-LZTS1 antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-Leucine zipper, putative tumor suppressor 1

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
£326.00

£326.00


Please contact Customer Service for Availability


Select a Size

Change View
100 μL
£326.00

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

£326.00


Please contact Customer Service for Availability

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

67 kDa

species reactivity

horse, rat, guinea pig, mouse, bovine, human

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... LZTS1(11178)

General description

Leucine zipper, putative tumor suppressor 1 (LZTS1) is a protein that regulates the molecular events involved in progression of cells through the M phase of mitosis. It functions as a tumor suppressor for a range of major cancer histotypes, such as bladder cancer and urothelial carcinomas. LZTS1 is transiently expressed at the border of the ventricular and mantle zones in subsets of sensory and motor spinal neurons.

Specificity

Anti-LZTS1 polyclonal antibody reacts with human, mouse, rat, bovine, and canine leucine zipper, putative tumor suppressor 1 proteins.

Immunogen

Synthetic peptide directed towards the C terminal region of human LZTS1

Application

Anti-LZTS1 polyclonal antibody is used to tag leucine zipper, putative tumor suppressor 1 protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of leucine zipper, putative tumor suppressor 1 as a tumor suppressor gene and mediator of M-phase cell cycle progression.

Biochem/physiol Actions

Leucine zipper putative tumor suppressor 1 (LZTS1) is a tumor suppressor gene involved in the cell growth activity.[1] It is down-regulated in several human malignancies. It retards the growth in cancer cells by regulating the mitotic process. It restricts Cdk1 (Cyclin-Dependent Kinase 1) activity by steadying the Cdc25C (cell division cycle 25C) phosphatase, a mitotic activator of Cdk1. Deregulation of this gene is associated with breast cancer and may serve as a prognostic factor for breast cancer therapy.[2][3] It is found to be down-regulated by promoter methylation.[4] This gene is found to be involved in ovarian carcinogenesis.[5]

Sequence

Synthetic peptide located within the following region: QQSYVAMYQRNQRLEKALQQLARGDSAGEPLEVDLEGADIPYEDIIATEI

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Andrea Vecchione et al.
Cancer cell, 11(3), 275-289 (2007-03-14)
The FEZ1/LZTS1 (LZTS1) protein is frequently downregulated in human cancers of different histotypes. LZTS1 is expressed in normal tissues, and its introduction in cancer cells inhibits cell growth and suppresses tumorigenicity, owing to an accumulation of cells in G2/M. Here
Francesca Lovat et al.
Oncotarget, 5(4), 970-977 (2014-01-23)
The Leucine Zipper Tumor Suppressor 1 (LZTS1) is a tumor suppressor gene, located at chromosome 8p22, which is frequently altered in human cancer. In normal tissue, its ubiquitous expression regulates cell mitosis by the stabilization of microtubule networks. LZTS1-deficient mouse
Daniela Califano et al.
Journal of cellular physiology, 222(2), 382-386 (2009-11-04)
The FEZ1/LZTS1 (FEZ1) gene maps to chromosome 8p22 and is frequently altered in human cancer. FEZ1 has been proposed as a candidate tumour suppressor gene and its loss may contribute to tumour progression. We have analysed the expression of FEZ1
Ling Chen et al.
Breast cancer research and treatment, 116(3), 471-478 (2008-08-08)
FEZ1/LZTS1 is a tumor suppressor gene located in chromosomal band 8p22, and methylation has been identified as a mechanism for its loss of function in tumors. Chromosomal deletion at 8p22 is also frequent in breast cancer. We therefore examined whether
H Ishii et al.
Proceedings of the National Academy of Sciences of the United States of America, 96(7), 3928-3933 (1999-03-31)
Alterations of human chromosome 8p occur frequently in many tumors. We identified a 1.5-Mb common region of allelic loss on 8p22 by allelotype analysis. cDNA selection allowed isolation of several genes, including FEZ1. The predicted Fez1 protein contained a leucine-zipper

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service