Skip to Content
Merck
All Photos(7)

Key Documents

HPA030551

Sigma-Aldrich

Anti-SLC43A3 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-DKFZp762A227, Anti-Eeg1, Anti-FLJ32069, Anti-FOAP-13, Anti-PRO1659, Anti-SEEEG-1, Anti-solute carrier family 43, member 3

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200

immunogen sequence

SFIFISVCSTWHVARTFLLMPRGHIPYPLPPNYSYGLCPGNGTTKEEKETAEHENRELQSKEFLSAKEETPGAGQKQELRSFWSYAFSR

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SLC43A3(29015)

General description

Solute carrier family 43 member 3 (SLC43A3) belongs to an amino acid transporter family. It is expressed in fetal liver, kidney, placenta and lung. It is considered as a facilitative and purine-selective nucleobase transporter. The gene is located on human chromosome 11q12.1.

Immunogen

solute carrier family 43, member 3 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

Solute carrier family 43 member 3 (SLC43A3) aids the cellular uptake of extracellular purine nucleobases in assistance with salvage enzymes. SLC43A3 along with salvage enzymes helps in tumor growth and proliferation. It helps in the uptake of ganciclovir (GCV) and improves the activity of herpes simplex virus thymidine kinase (HSV-TK)/GCV suicide gene therapy. The protein helps in the transport of nutrients, which is required for the early development and growth.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST72623

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Functional identification of SLC43A3 as an equilibrative nucleobase transporter involved in purine salvage in mammals
Furukawa J, et al.
Scientific Reports, 5(6), 15057-15057 (2015)
Role of equilibrative nucleobase transporter 1/SLC43A3 as a ganciclovir transporter in the induction of cytotoxic effect of ganciclovir in a suicide gene therapy with herpes simplex virus thymidine kinase
Furukawa J, et al.
Journal of Pharmacology and Experimental Therapeutics, 360(1), 59-68 (2017)
A genome-wide scan of Ashkenazi Jewish Crohn's disease suggests novel susceptibility loci
Kenny EE, et al.
PLoS Genetics, 8(3), e1002559-e1002559 (2012)
Nicholas M Ruel et al.
The Journal of pharmacology and experimental therapeutics, 382(3), 335-345 (2022-07-08)
6-Mercaptopurine (6-MP) is used extensively in the treatment of acute lymphoblastic leukemia (ALL) and inflammatory bowel diseases. Our laboratory determined previously, using a recombinant HEK293 cell model, that the SLC43A3-encoded equilibrative nucleobase transporter 1 (ENBT1) transports 6-MP into cells and
R O Stuart et al.
American journal of physiology. Renal physiology, 281(6), F1148-F1156 (2001-11-13)
A screen for genes differentially regulated in a model of kidney development identified the novel gene embryonic epithelia gene 1 (EEG1). EEG1 exists as two transcripts of 2.4 and 3.5 kb that are most highly expressed at embryonic day 7

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service