Accéder au contenu
Merck
Toutes les photos(1)

Principaux documents

WH0164832M1

Sigma-Aldrich

Monoclonal Anti-LONRF2 antibody produced in mouse

clone 1C7, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

Anti-FLJ45273, Anti-LON peptidase N-terminal domain and ring finger 2, Anti-MGC126711, Anti-MGC126713, Anti-RNF192

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41
Le tarif et la disponibilité ne sont pas disponibles actuellement.

Source biologique

mouse

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

1C7, monoclonal

Forme

buffered aqueous solution

Espèces réactives

human

Technique(s)

indirect ELISA: suitable

Isotype

IgG2aκ

Numéro d'accès GenBank

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... LONRF2(164832)

Description générale

The gene encoding LON peptidase N-terminal domain and ring finger 2 (LONRF2) is localized on human chromosome 2q11.2.

Immunogène

LONRF2 (NP_940863, 1 a.a. ~ 108 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MKNYEQALQDASAACQNEPLLIKGHQVKAQALSGLGRSKEVLKEFLYCLALNPECNSVKKEAQKVMCEVLFSATANVHENLTSSIQSRLKAQGHSHMNAQALLEEGDA

Actions biochimiques/physiologiques

LON peptidase N-terminal domain and ring finger 2 (LONRF2) has been linked to auto-immune diseases like rhematoid arthritis.

Caractéristiques et avantages

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

nwg

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

CLARITY: C hi L dhood A rthritis R isk Factor I dentification ST ud Y. Investigating the role of aberrant DNA methylation in juvenile idiopathic arthritis
J.A. Ellis
Pediatrics null
Sabyasachi Senapati et al.
European journal of human genetics : EJHG, 23(4), 530-535 (2014-07-24)
Studies in European populations have contributed to a better understanding of the genetics of complex diseases, for example, in coeliac disease (CeD), studies of over 23 000 European samples have reported association to the HLA locus and another 39 loci. However

Questions

Évaluations

Aucune valeur de notation

Filtres actifs

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique