WH0064375M1

Monoclonal Anti-ZNFN1A4 antibody produced in mouse

clone 4E6, ascites fluid

• Synonyme(s) : Anti-EOS, Anti-KIAA1782, Anti-zinc finger protein, subfamily 1A, 4 (Eos)
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: mouse
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: ascites fluid
• Type de produit anticorps: primary antibodies
• Clone: 4E6, monoclonal
• Espèces réactives: human
• Technique(s): indirect ELISA: suitable; western blot: 1:500-1:1000
• Isotype: IgMκ
• Numéro d'accès GenBank: NM_022465
• Numéro d'accès UniProt: Q9H2S9
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... IKZF4(64375)

Description

Description générale

Members of the Ikaros (ZNFN1A1; MIM 603023) family of transcription factors, which includes Eos, are expressed in lymphocytes and are implicated in the control of lymphoid development.[supplied by OMIM

Immunogène

IKZF4 (NP_071910, 2 a.a. ~ 108 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
DSRYLQLQLYLPSCSLLQGSGDSSLEKEFLGAPVGPSVSTPNSQHSSPSRSLSANSIKVEMYSDEESSRLLGPDERLLEKDDSVIVEDSLSEPLGYCDGSGPEPHSP

Forme physique

Solution

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): nwg
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable
• Équipement de protection individuelle: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)