Accéder au contenu
Merck
Toutes les photos(7)

Documents

WH0010146M1

Sigma-Aldrich

Monoclonal Anti-G3BP antibody produced in mouse

clone 2F3, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

Anti-HDHVIII, Anti-Ras-GTPase-activating protein SH3-domain-binding protein

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Numéro MDL:
Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

2F3, monoclonal

Forme

buffered aqueous solution

Espèces réactives

human

Technique(s)

ELISA: suitable
capture ELISA: suitable
immunofluorescence: suitable
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
western blot: 1-5 μg/mL

Isotype

IgG1κ

Numéro d'accès GenBank

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... G3BP1(10146)

Description générale

G3BP1 (Ras-GTPase-activating protein SH3 domain-binding protein 1) is a constituent of stress granules. It is located on human chromosome 5q14.2-5q33.3.

Immunogène

G3BP (AAH06997, 214 a.a. ~ 303 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KPEPVLEETAPEDAQKSSSPAPADIAQTVQEDLRTFSWASVTSKNLPPSGAVPVTGIPPHVVKVPASQPRPESKPESQIPPQRPQRDQRV

Actions biochimiques/physiologiques

G3BP1 (Ras-GTPase-activating protein SH3 domain-binding protein 1) blocks the replication of HIV-1 (human immunodeficiency virus) in macrophages and T-cells. In gastric cancer patients, overexpression of G3BP1 leads to imperfect clinical predictions. It is crucial for the interactions of SG–PB (stress granule-processing bodies).

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Novel Role of Ras-GTPase Activating Protein SH3 Domain-Binding Protein
G3BP in Adhesion and Migration of 32D Myeloid Progenitor Cells
Kerstin Schwarz
The Open Hematology Journal (2012)
G3BP1 restricts HIV-1 replication in macrophages and T-cells by sequestering viral RNA.
Cobos J
Virology (2015)
Sundararaghavan Pattabiraman et al.
Scientific reports, 10(1), 19525-19525 (2020-11-13)
Vimentin is one of the first cytoplasmic intermediate filaments to be expressed in mammalian cells during embryogenesis, but its role in cellular fitness has long been a mystery. Vimentin is acknowledged to play a role in cell stiffness, cell motility
G3BP1 promotes stress-induced RNA granule interactions to preserve polyadenylated mRNA
Anais A
The Journal of Cell Biology (2015)
Overexpression of Ras-GTPase-activating protein SH3 domain-binding protein 1 correlates with poor prognosis in gastric cancer patients.
Min L
Histopathology (2015)

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique