The sequence for Product SRP0164, Histone H4 (2-58) human is as follows:SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGV
SRP0164
Histone H4 (2-58) human
recombinant, expressed in E. coli, ≥70% (SDS-PAGE)
Synonyme(s) :
HIST2H4A
Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Sélectionner une taille de conditionnement
500 μG
354,00 €
Sélectionner une taille de conditionnement
Changer de vue
500 μG
354,00 €
About This Item
Code UNSPSC :
12352200
Nomenclature NACRES :
NA.77
Produits recommandés
Source biologique
human
Produit recombinant
expressed in E. coli
Essai
≥70% (SDS-PAGE)
Forme
aqueous solution
Poids mol.
32 kDa
Conditionnement
pkg of 500 μg
Conditions de stockage
avoid repeated freeze/thaw cycles
Numéro d'accès NCBI
Numéro d'accès UniProt
Conditions d'expédition
dry ice
Température de stockage
−70°C
Informations sur le gène
human ... HIST2H4A(8370)
Description générale
Human Histone 4 (GenBank Accession No. NM_003548), (2-58) with N-terminal GST-tag, MW = 32 kDa, expressed in an E. coli expression system.
Forme physique
Formulated in 25 mM Tris-HCl, pH 8.0, 100 mM NaCl, 0.05% Tween-20, 20% glycerol and 3 mM DTT.
Notes préparatoires
Thaw on ice. Upon first thaw, briefly spin tube containing enzyme to recover full content of the tube. Aliquot enzyme into single use aliquots. Store remaining undiluted enzyme in aliquots at -70°C. Note: Enzyme is very sensitive to freeze/thaw cycles.
Faites votre choix parmi les versions les plus récentes :
Certificats d'analyse (COA)
Lot/Batch Number
Vous ne trouvez pas la bonne version ?
Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.
Déjà en possession de ce produit ?
Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.
-
What is the amino acid sequence of Histone H4 (2-58) human, Product SRP0164?
1 réponse-
Utile ?
-
-
What is the Department of Transportation shipping information for this product?
1 réponse-
Transportation information can be found in Section 14 of the product's (M)SDS.To access the shipping information for this material, use the link on the product detail page for the product.
Utile ?
-
Filtres actifs
Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..
Contacter notre Service technique
