SAB5702998

Anti-UPF1/RENT1 Antibody, clone 5D5C4, Rabbit Monoclonal

• Synonyme(s) : HUPF1, NORF1, RENT1, pNORF1, smg-2
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.46

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Matériaux: colorless
• Clone: 5D5C4, monoclonal
• Forme: liquid
• Poids mol.: 140 kDa
• Espèces réactives: rat, human, rat
• Concentration: 0.4mg/ml
• Technique(s): immunofluorescence: 1:50 - 1:200; immunoprecipitation (IP): 1:50 - 1:200; western blot: 1:500 - 1:2000
• Couleur: colorless
• Isotype: IgG
• Séquence immunogène: MSVEAYGPSSQTLTFLDTEEAELLGADTQGSEFEFTDFTLPSQTQTPPGGPGGPGGGGAGGPGGAGAGAAAGQLDAQVGPEGILQNGAVDDSVAKTSQLL
• Numéro d'accès UniProt: Q92900
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... UPF1(5976)

Description

Description générale

This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. This protein is located only in the cytoplasm. When translation ends, it interacts with the protein that is a functional homolog of yeast Upf2p to trigger mRNA decapping. Use of multiple polyadenylation sites has been noted for this gene. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]

Immunogène

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human UPF1/RENT1 (Q92900).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Application

WB,IF/ICC, IP

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1