SAB5702306

Anti-HEC1/NDC80 Antibody, clone 4W2Y2, Rabbit Monoclonal

• Synonyme(s) : HEC, HEC1, HsHec1, KNTC2, TID3, hsNDC80
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.46

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Matériaux: colorless
• Clone: 4W2Y2, monoclonal
• Forme: liquid
• Poids mol.: 76 kDa
• Espèces réactives: human
• Concentration: 0.16 mg/mL
• Technique(s): western blot: 1:500 - 1:2000
• Couleur: colorless
• Isotype: IgG
• Séquence immunogène: ESTVNQGLSEAMNELDAVQREYQLVVQTTTEERRKVGNNLQRLLEMVATHVGSVEKHLEEQIAKVDREYEECMSEDLSENIKEIRDKYEKKATLIKSSEE
• Numéro d'accès UniProt: O14777
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... NDC80(10403)

Description

Description générale

This gene encodes a component of the NDC80 kinetochore complex. The encoded protein consists of an N-terminal microtubule binding domain and a C-terminal coiled-coiled domain that interacts with other components of the complex. This protein functions to organize and stabilize microtubule-kinetochore interactions and is required for proper chromosome segregation. [provided by RefSeq, Oct 2011]

Immunogène

A synthetic peptide corresponding to a sequence within amino acids 543-642 of human HEC1/NDC80 (O14777).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Application

WB

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1