SAB5702251

Anti-YKL-40/CHI3L1 Antibody, clone 7T1R3, Rabbit Monoclonal

• Synonyme(s) : CHI3L1,ASRT7,CGP-39,GP-39,GP39,HC-gp39,HCGP-3P,YKL-40,YKL40,YYL-40,hCGP-39
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.46

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Matériaux: colorless
• Clone: 7T1R3, monoclonal
• Forme: liquid
• Poids mol.: 30-43 kDa
• Espèces réactives: mouse, mouse
• Concentration: 1.00 mg/mL
• Technique(s): immunofluorescence: 1:50 - 1:200; western blot: 1:500 - 1:1000
• Couleur: colorless
• Isotype: IgG
• Séquence immunogène: PGRFTKEAGTLAYYEICDFLRGATVHRILGQQVPYATKGNQWVGYDDQESVKSKVQYLKDRQLAGAMVWALDLDDFQGSFCGQDLRFPLTNAIKDALAAT
• Numéro d'accès UniProt: P36222
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... CHI3L1(1116)

Description

Description générale

Chitinases catalyze the hydrolysis of chitin, which is an abundant glycopolymer found in insect exoskeletons and fungal cell walls. The glycoside hydrolase 18 family of chitinases includes eight human family members. This gene encodes a glycoprotein member of the glycosyl hydrolase 18 family. The protein lacks chitinase activity and is secreted by activated macrophages, chondrocytes, neutrophils and synovial cells. The protein is thought to play a role in the process of inflammation and tissue remodeling.

Immunogène

A synthetic peptide corresponding to a sequence within amino acids 284-383 of human YKL-40/CHI3L1 (NP_001267.2).

PBS with 0.05% proclin300,0.05% BSA,50% glycerol,pH7.3.

Application

WB, IF/ICC

Informations sur la sécurité

• Pictogrammes: GHS07,GHS09
• Mention d'avertissement: Warning
• Mentions de danger: H317,H411
• Conseils de prudence: P261 - P272 - P273 - P280 - P302 + P352 - P333 + P313
• Classification des risques: Aquatic Chronic 2 - Skin Sens. 1
• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3