SAB5702092

Anti-Cathepsin B Antibody, clone 6I5D7, Rabbit Monoclonal

• Synonyme(s) : APPS,CPSB,Cathepsin B,CTSB
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.46

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Matériaux: colorless
• Clone: 6I5D7, monoclonal
• Forme: liquid
• Poids mol.: 44 kDa
• Espèces réactives: human
• Concentration: 0.80 mg/mL
• Technique(s): immunohistochemistry: 1:50 - 1:200; western blot: 1:500 - 1:2000
• Couleur: colorless
• Isotype: IgG
• Séquence immunogène: SDELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPA
• Numéro d'accès UniProt: P07858
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... CTSB(1508)

Description

Description générale

This gene encodes a member of the C1 family of peptidases. Alternative splicing of this gene results in multiple transcript variants. At least one of these variants encodes a preproprotein that is proteolytically processed to generate multiple protein products. These products include the cathepsin B light and heavy chains, which can dimerize to form the double chain form of the enzyme. This enzyme is a lysosomal cysteine protease with both endopeptidase and exopeptidase activity that may play a role in protein turnover. It is also known as amyloid precursor protein secretase and is involved in the proteolytic processing of amyloid precursor protein (APP). Incomplete proteolytic processing of APP has been suggested to be a causative factor in Alzheimer's disease, the most common cause of dementia. Overexpression of the encoded protein has been associated with esophageal adenocarcinoma and other tumors. Multiple pseudogenes of this gene have been identified. [provided by RefSeq, Nov 2015]

Immunogène

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Recombinant fusion protein containing a sequence corresponding to amino acids 27-156 of human Cathepsin B (P07858).

Application

WB, IHC

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1