Accéder au contenu
Merck
Toutes les photos(2)

Principaux documents

SAB2109073

Sigma-Aldrich

Anti-USP30 antibody produced in rabbit

Anti-USP30 antibody produced in rabbit
1 sur 1 consommateurs ont reçu un échantillon de produit ou ont participé à une promotion

affinity isolated antibody

Synonyme(s) :

FLJ40511, MGC10702

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

100 μL
327,00 €

327,00 €


Check Cart for Availability


Sélectionner une taille de conditionnement

Changer de vue
100 μL
327,00 €

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.43

327,00 €


Check Cart for Availability

Source biologique

rabbit

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

57 kDa

Réactivité de l'espèce (prédite par homologie)

canine, rabbit, horse, human, bovine, rat, guinea pig, mouse

Concentration

0.5 mg/mL

Technique(s)

western blot: 1 μg/mL

Numéro d'accès NCBI

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... USP30(57396)

Description générale

USP30, a member of the ubiquitin-specific protease family (see USP1, MIM 603478), is a novel mitochondrial deubiquitinating (DUB) enzyme (Nakamura and Hirose, 2008 [PubMed 18287522]).

Immunogène

Synthetic peptide directed towards the middle region of human USP30

Séquence

Synthetic peptide located within the following region: SCLLDVLRMYRWQISSFEEQDAHELFHVITSSLEDERDRQPRVTHLFDVH

Forme physique

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

nwg

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

It looks like we've run into a problem, but you can still download Certificates of Analysis from our Documents section.

Si vous avez besoin d'assistance, veuillez contacter Service Clients

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Questions

Évaluations

1 sur 1 consommateurs ont reçu un échantillon de produit ou ont participé à une promotion

Filtres actifs

  1. Pennsylvania
    • Avis 1
    • Vote 1
    1 sur 5 étoiles.

    This antibody does not work

    We tested this antibody using 1 ug/ml and 2 ug/ml concentration in western blot and it did not work for protein extracted from human cells (HepG2), mouse cells (AML12) and male & female C57BL/6 mice liver. We used GAPDH as loading control and it worked perfectly, giving clear bands in those samples. However, no band was detected for USP30 using this antibody even at 2 ug/ml i.e 1:250 dilution of the antibody. This is a complete waste of money and the product should have been well validated before sale.

    Traduire avec Google

    Utile ?

    1. Réponse de Sigma-Aldrich Corporation :

      Thank you for taking the time to leave a review! We are sorry to hear that your experience did not meet expectations. We would like to learn more about your experience to see if there is anything we can do to help troubleshoot this issue. When you have a moment, please contact us by visiting https://www.sigmaaldrich.com/support/customer-support and submit a Report Product Issue ticket. We look forward to hearing from you soon!

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique