Accéder au contenu
Merck
Toutes les photos(4)

Documents

SAB2104153

Sigma-Aldrich

Anti-ZFR antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-FLJ41312

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(4)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

117 kDa

Espèces réactives

bovine, rat, mouse, horse, human, rabbit, dog

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunohistochemistry: suitable
western blot: suitable

Numéro d'accès NCBI

NM_016107

Numéro d'accès UniProt

Q96KR1

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... ZFR(51663)

Description générale

Zinc finger RNA binding protein (ZFR) is a highly conserved protein and is homologous to mouse ZFR. It is essential in the early developmental stages. ZFR has three N-terminal C2H2 zinc finger motifs and a C-terminal DZF (domain associated with zinc fingers) domain. ZFR is highly expressed in brain, whereas skeletal muscles is devoid of ZFR expression. In human chromosome, the gene ZFR is localized on 5p13.3.

Immunogène

Synthetic peptide directed towards the middle region of human ZFR

Application

Anti-ZFR antibody produced in rabbit has been used in western blot analysis.

Actions biochimiques/physiologiques

Zinc finger RNA binding protein (ZFR) binds to RNA and DNA and promotes DNA repair and chromosome organisation. ZFR regulates alternative pre-mRNA splicing and suppress interferon 1 expression in tissues. ZFR is a key factor in regulating transcription in macrophages. ZFR is critical for Staufen 2 isoform specific nucleocytoplasmic shuttling in neurons. ZFR is a potent marker and therapeutic target in cancer. ZFR is highly expressed in pancreatic cancer and knockdown of which suppressed the tumor cell growth and proliferation. ZFR is overexpressed in non-small-cell lung carcinoma (NSCLC) and causes cell growth and metastasis.

Séquence

Synthetic peptide located within the following region: RQIHKVLGMDPLPQMSQRFNIHNNRKRRRDSDGVDGFEAEGKKDKKDYDN

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

ZFR coordinates crosstalk between RNA decay and transcription in innate immunity
Haque N, et al.
Nature Communications, 9(1), 1145-1145 (2018)
DHX9 suppresses RNA processing defects originating from the Alu invasion of the human genome
Aktas T, et al.
Nature, 544(7648), 115-115 (2017)
Xiaolan Zhao et al.
Biological research, 49(1), 26-26 (2016-05-15)
Zinc finger RNA binding protein (ZFR) is involved in the regulation of growth and cancer development. However, little is known about ZFR function in pancreatic cancer. Herein, to investigate whether ZFR is involved in tumor growth, Oncomine microarray data was
Knockdown of ZFR suppresses cell proliferation and invasion of human pancreatic cancer
Zhao X, et al.
Biological Research, 49(1), 26-26 (2016)
Identification of a locus for autosomal dominant high myopia on chromosome 5p13. 3-p15. 1 in a Chinese family
Ma JH, et al.
Molecular Vision, 16(1), 2043-2043 (2010)
Afficher tous les articles scientifiques apparentés

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique