SAB1412513

ANTI-SMAD6 antibody produced in mouse

clone 4F3, purified immunoglobulin, buffered aqueous solution

• Synonyme(s) : HsT17432, MADH6, MADH7, SMAD6
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: mouse
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: 4F3, monoclonal
• Forme: buffered aqueous solution
• Poids mol.: antigen 36.74 kDa
• Espèces réactives: human
• Technique(s): immunohistochemistry: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotype: IgG2bκ
• Numéro d'accès NCBI: NM_005585
• Numéro d'accès UniProt: O43541
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... SMAD6(4091)

Description

Description générale

SMAD family member 6 (SMAD6) is encoded by the gene mapped to human chromosome 15q22.31. The encoded protein is localized in both nuclei and cytoplasm and is expressed in variety of human tissues, including ovary. SMAD6 consists of MAD homology 2 (MH2) domain involved in protein-protein interaction.

The protein encoded by this gene belongs to the SMAD family of proteins, which are related to Drosophila ‘ mothers against decapentaplegic ′ (Mad) and C. elegans Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein functions in the negative regulation of BMP and TGF-beta/activin-signalling. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogène

SMAD6 (NP_005576, 285 a.a. ~ 384 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
RDEYKPLDLSDSTLSYTETEATNSLITAPGEFSDASMSPDATKPSHWCSVAYWEHRTRVGRLYAVYDQAVSIFYDLPQGSGFCLGQLNLEQRSESVRRTR

Actions biochimiques/physiologiques

SMAD family member 6 (SMAD6) induces endocytosis and negatively regulates apoptosis by inhibiting transforming growth factor-β (TGF-β) signaling pathway. In addition, it also indirectly regulates stemness by inhibiting erythropoiesis in cord blood hematopoietic stem cells (HSCs). Mutation in the gene leads to congenital cardiovascular malformation (CVM). Elevated expression/genetic variation of SMAD6 is associated with the development of ovarian cancer.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable