Accéder au contenu
Merck
Toutes les photos(2)

Principaux documents

SAB1410841

Sigma-Aldrich

Anti-ATP1B3 antibody produced in rabbit

purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

ATPB-3, CD298, FLJ29027

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

100 μG
368,00 €

368,00 €


Check Cart for Availability


Sélectionner une taille de conditionnement

Changer de vue
100 μG
368,00 €

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

368,00 €


Check Cart for Availability

Source biologique

rabbit

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

antigen 31.5 kDa

Espèces réactives

human, rat

Technique(s)

western blot: 1 μg/mL

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... ATP1B3(483)

Description générale

ATPase Na+/K+ transporting subunit Β 3 (ATP1B3) is a 43kDa protein, encoded by the gene mapped to human chromosome 3q23. The encoded protein is a member of subfamily of Na+/K+ -ATPases.

Immunogène

ATP1B3 (NP_001670.1, 1 a.a. ~ 279 a.a) full-length human protein.

Sequence
MTKNEKKSLNQSLAEWKLFIYNPTTGEFLGRTAKSWGLILLFYLVFYGFLAALFSFTMWVMLQTLNDEVPKYRDQIPSPGLMVFPKPVTALEYTFSRSDPTSYAGYIEDLKKFLKPYTLEEQKNLTVCPDGALFEQKGPVYVACQFPISLLQACSGMNDPDFGYSQGNPCILVKMNRIIGLKPEGVPRIDCVSKNEDIPNVAVYPHNGMIDLKYFPYYGKKLHVGYLQPLVAVQVSFAPNNTGKEVTVECKIDGSANLKSQDDRDKFLGRVMFKITARA

Actions biochimiques/physiologiques

ATPase Na+/K+ transporting subunit Β 3 (ATP1B3) suppress enterovirus 71 (EV71) replication by elevating the production of type-I interferons, which might act as a potential target in treatment of EV71 infection. The encoded protein is also involved in the regulation of the immune response. Experimental study suggest that ATP1B3 can control restriction of HIV-1 production and nuclear factor Κ B (NF-ΚB) activation in a bone marrow stromal cell antigen 2 (BST-2) dependent manner. Elevated expression of ATP1B3 has been observed in colon and lung cancer.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Genetic markers associated with early cancer-specific mortality following prostatectomy.
Liu W
Cancer, 119, 2405-2412 (2013)
ATP1B3: a virus-induced host factor against EV71 replication by up-regulating the production of type-I interferons.
Lu Y
Virology, 496, 28-34 (2016)
Identification and characterization of angiogenesis targets through proteomic profiling of endothelial cells in human cancer tissues.
Mesri M
PLoS ONE, 8 (2013)

Questions

Évaluations

Aucune valeur de notation

Filtres actifs

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique