Accéder au contenu
Merck
Toutes les photos(3)

Principaux documents

SAB1410343

Sigma-Aldrich

Anti-STX2 antibody produced in rabbit

purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

EPIM, EPM, MGC51014, STX2A, STX2B, STX2C

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

100 μG
368,00 €

368,00 €


Check Cart for Availability


Sélectionner une taille de conditionnement

Changer de vue
100 μG
368,00 €

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

368,00 €


Check Cart for Availability

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

antigen 33.3 kDa

Espèces réactives

human

Technique(s)

western blot: 1 μg/mL

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... STX2(2054)

Description générale

Syntaxin 2 (STX2) is encoded by the gene mapped to human chromosome 12q24.33. The encoded protein is ubiquitously expressed and is mainly localized to plasma membrane. STX2 is a member of the soluble N-ethylmaleimide-sensitive factor activating protein receptor (SNARE) membrane fusion machinery.
The product of this gene belongs to the syntaxin/epimorphin family of proteins. The syntaxins are a large protein family implicated in the targeting and fusion of intracellular transport vesicles. The product of this gene regulates epithelial-mesenchymal interactions and epithelial cell morphogenesis and activation. Alternatively spliced transcript variants encoding different isoforms have been identified. (provided by RefSeq)

Immunogène

STX2 (NP_001971.2, 1 a.a. ~ 287 a.a) full-length human protein.

Sequence
MRDRLPDLTACRKNDDGDTVVVVEKDHFMDDFFHQVEEIRNSIDKITQYVEEVKKNHSIILSAPNPEGKIKEELEDLNKEIKKTANKIRAKLKAIEQSFDQDESGNRTSVDLRIRRTQHSVLSRKFVEAMAEYNEAQTLFRERSKGRIQRQLEITGRTTTDDELEEMLESGKPSIFTSDIISDSQITRQALNEIESRHKDIMKLETSIRELHEMFMDMAMFVETQGEMINNIERNVMNATDYVEHAKEETKKAIKYQSKARRKLMFIIICVIVLLVILGIILATTLS

Actions biochimiques/physiologiques

Syntaxin 2 (STX2) plays a vital role in expression, production and release of tissue plasminogen activator (tPA) protein. In mammalian cells, STX2 facilitates the fusion event required for cytokinesis. Deletion in the STX2 gene might be responsible for defective testicular development.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Genome-Wide Association Study for Circulating Tissue Plasminogen Activator Levels and Functional Follow-Up Implicates Endothelial STXBP5 and STX2Significance.
Huang J, et al.
Arteriosclerosis, Thrombosis, and Vascular Biology, 34(5), 1093-1101 (2014)
Syntaxin 2 and Endobrevin Are Required for the Terminal Step of Cytokinesis in Mammalian Cells
Low SH, et al.
Developmental Cell, 4(5), 753-759 (2003)
Chromosome 12q24.31-q24.33 deletion causes multiple dysmorphic features and developmental delay: First mosaic patient and overview of the phenotype related to 12q24qter defects
Al-Zahrani J, et al.
Molecular Cytogenetics, 4(1), 9-9 (2011)

Questions

Évaluations

Aucune valeur de notation

Filtres actifs

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique