SAB1409690

Monoclonal Anti-SMARCD3 antibody produced in mouse

clone 5B6, purified immunoglobulin, buffered aqueous solution

• Synonyme(s) : BAF60C, CRACD3, MGC111010, Rsc6p
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: mouse
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: 5B6, monoclonal
• Forme: buffered aqueous solution
• Poids mol.: antigen 36.63 kDa
• Espèces réactives: human, mouse
• Technique(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotype: IgG2aκ
• Numéro d'accès NCBI: NM_001003801
• Numéro d'accès UniProt: Q6STE5
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... SMARCD3(6604)

Description

Description générale

The protein encoded by this gene is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and has sequence similarity to the yeast Swp73 protein. Multiple alternatively spliced transcript variants have been found for this gene, but the biological validity of some variants has not been determined. (provided by RefSeq)

Immunogène

SMARCD3 (NP_001003801, 385 a.a. ~ 483 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ISALDSKIHETIESINQLKIQRDFMLSFSRDPKGYVQDLLRSQSRDLKVMTDVAGNPEEERRAEFYHQPWSQEAVSRYFYCKIQQRRQELEQSLVVRNT

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations sur la sécurité

• Code de la classe de stockage: 12 - Non Combustible Liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable