Accéder au contenu
Merck
Toutes les photos(1)

Principaux documents

SAB1405974

Sigma-Aldrich

Anti-HTN1 antibody produced in mouse

purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

HIS1

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

50 μG
368,00 €

368,00 €


Check Cart for Availability


Sélectionner une taille de conditionnement

Changer de vue
50 μG
368,00 €

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

368,00 €


Check Cart for Availability

Source biologique

mouse

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

antigen ~7 kDa

Espèces réactives

human

Technique(s)

western blot: 1 μg/mL

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... HTN1(3346)

Description générale

Histatin 1 (HTN1) is a histidine-rich phosphoprotein.HTN1 functions as an antimicrobial peptide with 38 amino acids. It is highly enriched in human saliva. HTN1 gene is located on human chromosome 4q13.3.

Immunogène

HTN1 (NP_002150.1, 1 a.a. ~ 57 a.a) full-length human protein.

Sequence
MKFFVFALVLALMISMISADSHEKRHHGYRRKFHEKHHSHREFPFYGDYGSNYLYDN

Actions biochimiques/physiologiques

Histatin 1 (HTN1) promotes migration of oral keratinocytes and fibroblasts in vitro. It also contributes to endothelial cell adhesion, migration and angiogenesis. HTN1 helps in oral wound healing. HTN1 is used as a marker for human lacrimal epithelium in accessory lacrimal gland (ALG) and cadaveric main lacrimal gland (MLG). HTN1 also has candidacidal activity and helps in mineralization by adsorbing to hydroxyapatite.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

A review of protein structure and gene organisation for proteins associated with mineralised tissue and calcium phosphate stabilisation encoded on human chromosome 4
Huq N, et al.
Archives of Oral Biology, 50(7) (2005)
The salivary peptide histatin-1 promotes endothelial cell adhesion, migration, and angiogenesis
Torres , et al.
Faseb Journal, 31(11) (2017)
Sushma Kalmodia et al.
Scientific reports, 9(1), 10304-10304 (2019-07-18)
The aims of this study were to determine if histatin-1 (H1) is present in normal human tears and whether tear levels of H1 varied between normal patients and those with aqueous deficient dry eye disease (ADDE). Patient samples were obtained
Histatin-1 expression in human lacrimal epithelium
Shah D, et al.
PLoS ONE, 11(1), e0148018-e0148018 (2016)
Menno J Oudhoff et al.
FASEB journal : official publication of the Federation of American Societies for Experimental Biology, 22(11), 3805-3812 (2008-07-25)
Wounds in the oral cavity heal much faster than skin lesions. Among other factors, saliva is generally assumed to be of relevance to this feature. Rodent saliva contains large amounts of growth factors such as epidermal growth factor (EGF) and

Questions

Évaluations

Aucune valeur de notation

Filtres actifs

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique