SAB1405104

Monoclonal Anti-TRIM33 antibody produced in mouse

clone 6F4, purified immunoglobulin, buffered aqueous solution

• Synonyme(s) : FLJ32925, PTC7, RFG7, TF1G, TIF1G, TIF1GAMMA, TIFGAMMA
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41
• Conjugué: unconjugated
• application: ELISA (i); IF; WB
• Clone: 6F4, monoclonal
• Espèces réactives: human
• Technique(s): indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL

Propriétés

• Source biologique: mouse
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: 6F4, monoclonal
• Forme: buffered aqueous solution
• Poids mol.: antigen ~37.11 kDa
• Espèces réactives: human
• Technique(s): indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• Isotype: IgG2aκ
• Numéro d'accès NCBI: NM_015906
• Numéro d'accès UniProt: Q9UPN9
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... TRIM33(51592)

Description

Description générale

The protein encoded by this gene is thought to be a transcriptional corepressor. However, molecules that interact with this protein have not yet been identified. The protein is a member of the tripartite motif family. This motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. Three alternatively spliced transcript variants for this gene have been described, however, the full-length nature of one variant has not been determined. (provided by RefSeq)

Immunogène

TRIM33 (NP_056990, 1006 a.a. ~ 1105 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
VKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYADTQEINLKADSEVAQAGKAVALYFEDKLTEIYSDRTFAPLPEFEQEEDDGEVTEDS

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable