SAB1404248

Monoclonal Anti-MAPK6, (C-terminal) antibody produced in mouse

clone 4C11, purified immunoglobulin, buffered aqueous solution

• Synonyme(s) : DKFZp686F03189, ERK3, HsT17250, PRKM6, p97MAPK
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: mouse
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: 4C11, monoclonal
• Forme: buffered aqueous solution
• Poids mol.: antigen ~38.1 kDa
• Espèces réactives: rat, mouse, human
• Technique(s): indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• Isotype: IgG2bκ
• Numéro d'accès NCBI: BC035492
• Numéro d'accès UniProt: Q16659
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... MAPK6(5597)

Description

Description générale

The protein encoded by this gene is a member of the Ser/Thr protein kinase family, and is most closely related to mitogen-activated protein kinases (MAP kinases). MAP kinases also known as extracellular signal-regulated kinases (ERKs), are activated through protein phosphorylation cascades and act as integration points for multiple biochemical signals. This kinase is localized in the nucleus, and has been reported to be activated in fibroblasts upon treatment with serum or phorbol esters. (provided by RefSeq)

Immunogène

MAPK6 (AAH35492, 612 a.a. ~ 721 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
EVRKDEQVEKENTYTSYLDKFFSRKEDTEMLETEPVEDGKLGERGHEEGFLNNSGEFLFNKQLESIGIPQFHSPVGSPLKSIQATLTPSAMKSSPQIPHQTYSSILKHLN

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable