SAB1403429

Monoclonal Anti-ACRC, (C-terminal) antibody produced in mouse

clone 2E4, purified immunoglobulin, buffered aqueous solution

• Synonyme(s) : NAAR1
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: mouse
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: 2E4, monoclonal
• Forme: buffered aqueous solution
• Poids mol.: antigen ~37.11 kDa
• Espèces réactives: human
• Technique(s): capture ELISA: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotype: IgG2aκ
• Numéro d'accès NCBI: NM_052957
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... ACRC(93953)

Description

Description générale

The gene ACRC (acidic repeat containing) is mapped to human chromosome Xq13.1 and contains at least 12 exons and 11 introns. It contains a characteristic acidic repeat region of 21 units of 8–10 amino acids. It is expressed ubiquitously, including skeletal muscle, liver, kidney, pancreas, heart, lung, and brain, with the highest expression in skeletal muscle.

Immunogène

ACRC (NP_443189.1, 592 a.a. ~ 691 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
HEMCHAASWLIDGIHDSHGDAWKYYARKSNRIHPELPRVTRCHNYKINYKVHYECTGCKTRIGCYTKSLDTSRFICAKCKGSLVMVPLTQKDGTRIVPHV

Actions biochimiques/physiologiques

The gene ACRC (acidic repeat containing) is localized on a critical region that harbors the disease locus for X-linked dystonia parkinsonism (XDP). However, mutation analysis in this gene does not implicate it in the disease.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations sur la sécurité

• Code de la classe de stockage: 13 - Non Combustible Solids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable