SAB1403423

Monoclonal Anti-SCGB3A1 antibody produced in mouse

clone 3G5, purified immunoglobulin, buffered aqueous solution

• Synonyme(s) : HIN-1, HIN1, LU105, MGC87867, PnSP-2, UGRP2
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: mouse
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: 3G5, monoclonal
• Forme: buffered aqueous solution
• Poids mol.: antigen ~37.55 kDa
• Espèces réactives: human
• Technique(s): capture ELISA: suitable; indirect ELISA: suitable
• Isotype: IgG2aκ
• Numéro d'accès NCBI: BC029176
• Numéro d'accès UniProt: Q96QR1
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... SCGB3A1(92304)

Description

Description générale

Secretoglobin family 3A member 1 (SCGB3A1) is a member of secretoglobin gene super family, which contains small secretory proteins. SCGB3A1 is expressed mainly in the epithelial organs, such as the lungs, breast glands, trachea, prostate and salivary glands. SCGB3A1 gene is located on human chromosome 5q35.3.

Immunogène

SCGB3A1 (AAH29176, 1 a.a. ~ 104 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MKLAALLGLCVALSCSSAAAFLVGSAKPVAQPVAALESAAEAGAGTLANPLGTLNPLKLLLSSLGIPVNHLIEGSQKCVAELGPQAVGAVKALKALLGALTVFG

Actions biochimiques/physiologiques

Secretoglobin family 3A member 1 (SCGB3A1) plays an important role in cell growth, migration and invasion as a potent inhibitor and these activities are mediated through protein kinase B (PKB/AKT) signal pathway. Aberrant mutations of SCGB3A1 may be used as a prognostic marker for breast cancer and other human malignancies. SCGB3A1 is used as an epigenetic marker for therapy selection in glioblastoma multiforme (GBM). SCGB3A1 plays an important role in inflammation.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable