SAB1403361

Monoclonal Anti-LENG4 antibody produced in mouse

clone 1D4, purified immunoglobulin, buffered aqueous solution

• Synonyme(s) : BB1, LENG4, LPIAT, hMBOA-7
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: mouse
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: 1D4, monoclonal
• Forme: buffered aqueous solution
• Poids mol.: antigen ~36.78 kDa
• Espèces réactives: human
• Technique(s): capture ELISA: suitable; indirect ELISA: suitable
• Isotype: IgG2aκ
• Numéro d'accès NCBI: NM_024298
• Numéro d'accès UniProt: Q96N66
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... MBOAT7(79143)

Description

Description générale

Membrane bound O-acyltransferase domain containing 7 (MBOAT7) or LENG4 belongs to membrane-bound O-acyltransferase family. The gene encoding it is localized on human chromosome 19q13.42.

Mouse monoclonal antibody raised against a partial recombinant LENG4.

Immunogène

LENG4 (NP_077274.2, 96 a.a. ~ 192 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
TPTPFTNAVQLLLTLKLVSLASEVQDLHLAQRKEMASGFSKGPTLGLLPDVPSLMETLSYSYCYVGIMTGPFFRYRTYLDWLEQPFPGAVPSLRPLL

Actions biochimiques/physiologiques

Membrane bound O-acyltransferase domain containing 7 (MBOAT7) or LENG4 is an integral membrane protein important for reacylation of phospholipids. LENG4 is highly specific for arachidonoyl-coenzyme A and is involved in arachidonate recycling. It interacts with the small subunit of serine palmitoyltransferase a (ssSPTa). This interaction is important for LENG4-dependent incorporation of arachidonic acid into phosphatidylinositol.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable