SAB1403337

Monoclonal Anti-CACNG7, (C-terminal) antibody produced in mouse

clone 1F7, purified immunoglobulin, buffered aqueous solution

• Synonyme(s) : Anti-CCG7, Anti-TARP gamma-7
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: mouse
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: 1F7, monoclonal
• Forme: buffered aqueous solution
• Poids mol.: antigen ~34.03 kDa
• Espèces réactives: human
• Technique(s): capture ELISA: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotype: IgG1κ
• Numéro d'accès NCBI: NM_031896
• Numéro d'accès UniProt: P62955
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... CACNG7(59284)

Description

Description générale

The mouse protein stargazin is one of five subunits comprising neuronal voltage-gated calcium channels. This subunit, gamma, is thought to stabilize the calcium channel in an inactive (closed) state. Mutations in the gene encoding stargazin have been associated with absence seizures, also known as petit-mal or spike-wave seizures. The protein encoded by this gene is structurally similar to the mouse stargazin protein and is a member of the neuronal calcium channel gamma subunit protein family. However, it appears unlikely that the encoded protein is part of a functional calcium channel. Rather, it appears to inhibit the expression of a specific calcium channel subunit. (provided by RefSeq)

Immunogène

CACNG7 (NP_114102.2, 203 a.a. ~ 274 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
RYAEEEMYRPHPAFYRPRLSDCSDYSGQFLQPEAWRRGRSPSDISSDVSIQMTQNYPPAIKYPDHLHISTSP

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable