Accéder au contenu
Merck
Toutes les photos(1)

Principaux documents

SAB1403333

Sigma-Aldrich

Monoclonal Anti-TNRC6C antibody produced in mouse

clone 3G11, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

FLJ20015, KIAA1582

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

3G11, monoclonal

Forme

buffered aqueous solution

Poids mol.

antigen ~36.89 kDa

Espèces réactives

human

Technique(s)

immunofluorescence: suitable
indirect ELISA: suitable

Isotype

IgG2aκ

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... TNRC6C(57690)

Description générale

Mouse monoclonal antibody raised against a partial recombinant TNRC6C.
TNRC6C (Trinucleotide repeat containing 6C) is a member of GW182 (Gly-Trp) family consisting of a domain similar to Drosophila GW182 (also known as Gawky), a domain rich in GW or WG repeats followed by a glutamine (Q)-rich region at the N-proximal end, a central ubiquitin-associated (UBA) domain and an RNA-binding domain termed as RRM.

Immunogène

TNRC6C (NP_061869, 181 a.a. ~ 280 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
TDGPNNTNPMNSSPNPINAMQTNGLPNWGMAVGMGAIIPPHLQGLPGANGSSVSQVSGGSAEGISNSVWGLSPGNPATGNSNSGFSQGNGDTVNSALSAK

Application

Monoclonal Anti-TNRC6C antibody produced mouse is suitable for indirect ELISA.

Actions biochimiques/physiologiques

TNRC6C (Trinucleotide repeat containing 6C) plays an important role in the microRNA repression during protein synthesis via miRNA pathway. The C-terminal RRM RNA-binding domain mediates the process of translational repression. Its GW-rich and Q-rich domain also suppress the expression for protein synthesis by binding to a reporter mRNA. In addition to translational repression, the members of the GW182 family, also participate in the deadenylation and decay of miRNA by interacting with argonaute proteins.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Latifa Zekri et al.
The EMBO journal, 32(7), 1052-1065 (2013-03-07)
GW182 family proteins interact with Argonaute proteins and are required for the translational repression, deadenylation and decay of miRNA targets. To elicit these effects, GW182 proteins interact with poly(A)-binding protein (PABP) and the CCR4-NOT deadenylase complex. Although the mechanism of
Jakob T Zipprich et al.
RNA (New York, N.Y.), 15(5), 781-793 (2009-03-24)
Proteins of the GW182 family play an important role in the execution of microRNA repression in metazoa. They interact directly with Argonaute proteins, components of microRNPs, and also form part of P-bodies, structures implicated in translational repression and mRNA degradation.

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique