SAB1403067

Monoclonal Anti-LYPLA1 antibody produced in mouse

clone 3D5, purified immunoglobulin, buffered aqueous solution

• Synonyme(s) : APT-1, LPL1, LYSOPLA
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: mouse
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: 3D5, monoclonal
• Forme: buffered aqueous solution
• Poids mol.: antigen ~35.57 kDa
• Espèces réactives: human
• Technique(s): capture ELISA: suitable; immunofluorescence: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotype: IgG2aκ
• Numéro d'accès NCBI: BC008652
• Numéro d'accès UniProt: O75608
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... LYPLA1(10434)

Description

Description générale

Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. The protein encoded by this gene hydrolyzes lysophosphatidylcholine in both monomeric and micellar forms. The use of alternate polyadenylation sites has been found for this gene. There are alternatively spliced transcript variants described for this gene but the full length nature is not known yet. (provided by RefSeq)

Immunogène

LYPLA1 (AAH08652.1, 66 a.a. ~ 151 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
NVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRAS

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable