SAB1402559

Monoclonal Anti-PVRL3 antibody produced in mouse

clone 1D1, purified immunoglobulin, buffered aqueous solution

• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: mouse
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: 1D1, monoclonal
• Forme: buffered aqueous solution
• Poids mol.: antigen ~37.99 kDa
• Espèces réactives: human
• Technique(s): immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotype: IgG2aκ
• Numéro d'accès NCBI: NM_015480
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... PVRL3(25945)

Description

Description générale

Poliovirus receptor-related 3 (PVRL3), popularly known as nectin cell adhesion molecule 3 (NECTIN3), is expressed in various cells. It is part of the nectin family of proteins, which are cell adhesion molecules that modulate adherens junction formation. PVRL3 is a membrane protein with three extracellular immunoglobulin domains. The gene encoding it is localized on human chromosome 3q13.13.

Immunogène

PVRL3 (NP_056295, 59 a.a. ~ 166 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PIIVEPHVTAVWGKNVSLKCLIEVNETITQISWEKIHGKSSQTVAVHHPQYGFSVQGEYQGRVLFKNYSLNDATITLHNIGFSDSGKYICKAVTFPLGNAQSSTTVTV

Application

Monoclonal Anti-PVRL3 antibody produced in mouse has been used for immunohistochemistry.

Actions biochimiques/physiologiques

Poliovirus receptor-related 3 (PVRL3) or nectin cell adhesion molecule 3 (NECTIN3) forms heterotypic adhesions with PVR, PVRL1 and PVRL2. The protein is involved in lymphocyte and monocyte extravasation. It also associates with afadin. PVRL3 has a role in the development of mammalian lens and ciliary body.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable