Accéder au contenu
Merck
Toutes les photos(3)

Principaux documents

SAB1401583

Sigma-Aldrich

Monoclonal Anti-STAB1 antibody produced in mouse

clone 4G9, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

CLEVER-1, FEEL-1, FELE-1, FEX1, KIAA0246, STAB-1

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

100 μG
490,00 €

490,00 €


Date d'expédition estimée le30 avril 2025



Sélectionner une taille de conditionnement

Changer de vue
100 μG
490,00 €

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

490,00 €


Date d'expédition estimée le30 avril 2025


Source biologique

mouse

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

4G9, monoclonal

Forme

buffered aqueous solution

Espèces réactives

human

Technique(s)

capture ELISA: suitable
immunofluorescence: suitable
western blot: 1-5 μg/mL

Isotype

IgG2aκ

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... STAB1(23166)

Description générale

Stabilin 1 (STAB1) gene encodes a large, transmembrane receptor protein which may function in angiogenesis, lymphocyte homing, cell adhesion, or receptor scavenging. The protein contains 7 fasciclin, 16 epidermal growth factor (EGF)-like, and 2 laminin-type EGF-like domains as well as a C-type lectin-like hyaluronan-binding Link module. The protein is primarily expressed on sinusoidal endothelial cells of liver, spleen, and lymph node. The receptor has been shown to endocytose ligands such as low density lipoprotein, Gram-positive and Gram-negative bacteria, and advanced glycosylation end products. Supporting its possible role as a scavenger receptor, the protein rapidly cycles between the plasma membrane and early endosomes. (provided by RefSeq).
Stabilin 1 (STAB1) is expressed on tissue macrophages and sinusoidal endothelial cells. It is a type-1 transmembrane receptor. STAB1 is expressed in alternatively activated macrophages. STAB1 gene is located on human chromosome 3p21.1.

Immunogène

STAB1 (NP_055951, 1804 a.a. ~ 1902 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
EALASDLPNLGPLRTMHGTPISFSCSRTRAGELMVGEDDARIVQRHLPFEGGLAYGIDQLLEPPGLGARCDHFETRPLRLNTCSICGLEPPCPEGSQEQ

Actions biochimiques/physiologiques

Stabilin 1 (STAB1) maintains tissue homeostasis and prevents autoimmunity. STAB1 mediates endocytic and phagocytic clearance of undesirable internal components. STAB1 is an immunosuppressive molecule and reduces proinflammatory reactions in vivo.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Multifunctional receptor stabilin-1 in homeostasis and disease
Kzhyshkowska J, et al.
TheScientificWorldJournal, 10(1) (2010)
Stabilin-1 mediates phosphatidylserine-dependent clearance of cell corpses in alternatively activated macrophages
Park S, et al.
Journal of Cell Science, 122(18) (2009)
Monocyte Stabilin-1 suppresses the activation of TH1 lymphocytes
Palani S, et al.
Journal of Immunology, 1500257-1500257 (2015)
Stabilin-1, a homeostatic scavenger receptor with multiple functions
Kzhyshkowska J, et al.
Journal of Cellular and Molecular Medicine, 10(3) (2006)
Allelic expression analysis of the osteoarthritis susceptibility locus that maps to chromosome 3p21 reveals cis-acting eQTLs at GNL3 and SPCS1
Gee F, et al.
BMC Medical Genetics, 15(1), 53-53 (2014)

Questions

Évaluations

Aucune valeur de notation

Filtres actifs

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique