SAB1401265

Monoclonal Anti-NNAT antibody produced in mouse

clone 1B9, purified immunoglobulin, buffered aqueous solution

• Synonyme(s) : MGC1439, Peg5
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: mouse
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: 1B9, monoclonal
• Forme: buffered aqueous solution
• Espèces réactives: human
• Technique(s): capture ELISA: suitable
• Isotype: IgG2aκ
• Numéro d'accès NCBI: NM_005386
• Numéro d'accès UniProt: Q16517
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... NNAT(4826)

Description

Description générale

The protein encoded by this gene is a proteolipid that may be involved in the regulation of ion channels during brain development. The encoded protein may also play a role in forming and maintaining the structure of the nervous system. This gene is found within an intron of the BLCAP gene, but on the opposite strand. This gene is imprinted and is expressed only from the paternal allele, while BLCAP is not imprinted. Two transcript variants encoding two different isoforms have been found for this gene. (provided by RefSeq)

Immunogène

NNAT (NP_005377.1, 22 a.a. ~ 81 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LLQVFLECCIYWVGFAFRNPPGTQPIARSEVFRYSLQKLAYTVSRTGRQVLGERRQRAPN

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable