Accéder au contenu
Merck
Toutes les photos(1)

Documents

HPA026797

Sigma-Aldrich

Anti-DGKQ antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonyme(s) :

Anti-DAGK, Anti-DAGK4, Anti-DAGK7, Anti-diacylglycerol kinase

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Numéro HPA (Human Protein Atlas):
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Gamme de produits

Prestige Antibodies® Powered by Atlas Antibodies

Forme

buffered aqueous glycerol solution

Espèces réactives

human

Technique(s)

immunohistochemistry: 1:20- 1:50

Séquence immunogène

HVSLFVGGLPPGLSPEEYSSLLHEAGATKATVVSVSHIYSSQGAVVLDVACFAEAERLYMLLKDMAVRGRLLTALVLPDLLHAKLPPDSCPLLVFVNPKSG

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... DGKQ(1609)

Description générale

Diacylglycerol kinase θ (DGKθ) of 941 amino acids with molecular mass of ~ 110 kDa is encoded by a gene mapped to human chromosome 4p16.3. DGKθ, also known as diacylglycerol kinase 4 (DAGK4), belongs to group V of DGK protein family. It is characterized with three cysteine-rich domains, N-terminal proline/ glycine-rich domain, a pleckstrin homology domain and Ras-associating domain. DGKθ needs polybasic cofactor and acidic phospholipids for its absolute activity. DGKθ is highly expressed in brain and at low level in the small intestine, duodenum and liver.

Immunogène

diacylglycerol kinase, theta 110kDa recombinant protein epitope signature tag (PrEST)

Application

Anti-DGKQ antibody produced in rabbit has been used in western blotting. All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

Actions biochimiques/physiologiques

Diacylglycerol kinase theta (DGKθ) plays a vital role in synthesizing phosphatidic acid (PA) ligand for the nuclear receptor steroidogenic factor 1 (SF1) and functions in the regulation of adrenocortical steroidogenesis. DGKθ expression is essential for SF1/cAMP (cyclic adenosine monophosphate) stimulated CYP17A1 (Cytochrome P450 17A1) transcription and it also promotes steroid hormone production in human adrenocortical cells.

Caractéristiques et avantages

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST86847

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Mammalian diacylglycerol kinases, a family of lipid kinases with signaling functions.
Topham MK, Prescott SM
The Journal of Biological Chemistry, 274(17), 11447-11450 (1999)
Cloning of a novel human diacylglycerol kinase (DGKtheta) containing three cysteine-rich domains, a proline-rich region, and a pleckstrin homology domain with an overlapping Ras-associating domain.
Houssa B
The Journal of Biological Chemistry, 272(16), 10422-10428 (1997)
Assignment of the human diacylglycerol kinase 4 (DAGK4) gene to chromosome 4p16.3.
Endele S
Genomics, 33(1), 145-146 (1996)
Becky Tu-Sekine et al.
The Journal of biological chemistry, 287(50), 41619-41627 (2012-10-24)
Diacylglycerol kinases are important mediators of lipid signaling cascades, and insight into their regulation is of increasing interest. Using purified DGK-θ, we show that this isoform is subject to dual regulation and that the previously characterized stimulation by acidic phospholipids
Kai Cai et al.
Journal of lipid research, 54(8), 2121-2132 (2013-04-24)
Diacylglycerol kinase (DGK)θ is a lipid kinase that phosphorylates diacylglycerol to form phosphatidic acid (PA). We have previously shown that PA is a ligand for the nuclear receptor steroidogenic factor 1 (SF1) and that cAMP-stimulated expression of SF1 target genes

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique