HPA015015

Anti-SCYL1 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonyme(s) : Anti-N-terminal kinase-like protein, Anti-SCY1-like protein 1, Anti-Telomerase regulation-associated protein, Anti-Telomerase transcriptional element-interacting factor, Anti-Teratoma-associated tyrosine kinase
• Code UNSPSC : 12352203
• Numéro HPA (Human Protein Atlas): HPA015015
• Nomenclature NACRES : NA.43

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Gamme de produits: Prestige Antibodies^® Powered by Atlas Antibodies
• Forme: buffered aqueous glycerol solution
• Espèces réactives: human
• Technique(s): immunofluorescence: 0.25-2 μg/mL
• Séquence immunogène: AFPEDFCRHKVLPQLLTAFEFGNAGAVVLTPLFKVGKFLSAEEYQQKIIPVVVKMFSSTDRAMRIRLLQQMEQFIQYLDEPTVNTQIFPHVVHGFLDTNPAIREQTVKSMLLLAPKLNEANLNVELMK
• Numéro d'accès UniProt: Q96KG9
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... SCYL1(57410)

Description

Description générale

SCYL1 (SCY1-like, kinase-like 1) belongs to the catalytically non-functional protein kinase family called Scy1-like protein family. It has a RKXX-COO^- motif present at its C-terminal. It has a protein kinase-like domain at its N-terminal domain, and this protein is evolutionarily conserved. It is also called TEIF (telomerase transcriptional elements­interacting factor), acts as a transcription factor, and resides in centrosome. This gene is localized to human chromosome 11q13.

Immunogène

N-terminal kinase-like protein recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Actions biochimiques/physiologiques

SCYL1 (SCY1-like, kinase-like 1) is involved in the COPI (coat protein)-mediated retrograde intracellular transport. It interacts with the appendage domain of COPG2 (coatomer subunit γ-2) through its RKXX-COO^- sequence. Simultaneously, it interacts with Arf4, and other class II Arfs, and links them with COPG2-containing COPI complexes. Thus, it plays a key role in the organization of COPI coats, and acts as a scaffold for the same. In murine model, its inactivation results in motor neuron disease. It is a part of the nuclear tRNA export pathway, which is aminoacylation-dependent. It ensures the unloading of aminoacyl-tRNAs through nuclear pore complex, into the cytoplasm, from the nuclear tRNA export receptor. This protein is up-regulated in colorectal cancer (CRC), and this is related to the histological grade and the malignancy of CRC. This is also linked to centrosome amplification in CRC.

Caractéristiques et avantages

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST73500

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable
• Équipement de protection individuelle: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)