Accéder au contenu
Merck
Toutes les photos(3)

Principaux documents

HPA011209

Sigma-Aldrich

Anti-FGF4 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonyme(s) :

Anti-FGF-4, Anti-Fibroblast growth factor 4 precursor, Anti-HBGF-4, Anti-HST, Anti-HST-1, Anti-Heparin secretory-transforming protein, Anti-Transforming protein KS3

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

100 μL
490,00 €

490,00 €


Check Cart for Availability


Sélectionner une taille de conditionnement

Changer de vue
100 μL
490,00 €

About This Item

Code UNSPSC :
12352203
Numéro HPA (Human Protein Atlas):
Nomenclature NACRES :
NA.41

490,00 €


Check Cart for Availability

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Gamme de produits

Prestige Antibodies® Powered by Atlas Antibodies

Forme

buffered aqueous glycerol solution

Espèces réactives

human

Validation améliorée

recombinant expression
Learn more about Antibody Enhanced Validation

Technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:20-1:50

Séquence immunogène

VVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFL

Numéro d'accès UniProt

Application(s)

research pathology

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... FGF4(2249)

Description générale

FGF4 (fibroblast growth factor 4) is a part of FGF family of secreted signaling proteins. FGF family consists of 22 heparin-binding polypeptides. FGF4 conforms in to the β-trefoil fold like other FGF members, and consists of a signal peptide. It was first identified in the screening of Kaposi′s sarcoma and human stomach cancers. This protein is made of 206 amino acids, and contains an N-glycosylation site. This gene is expressed during gastrula and early somite stage embryos, in proximity to the posterior endoderm. In the gut endoderm, it shows an anterior-posterior expression pattern. In adult humans, it is expressed in nervous system, intestines and testis. It is located on human chromosome 11q13.

Immunogène

Fibroblast growth factor 4 precursor recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Actions biochimiques/physiologiques

FGF4 (fibroblast growth factor 4) plays an important role in embryogenesis, and is involved in the patterning and survival of embryo. It is responsible for the activation of IIIc splice forms of FGFR1 to 3 by binding to them. Its expression in the initial stages is essential for the successful formation of induced pluripotent stem cells (iPSCs). This is achieved by the interaction of Artd1 (ADP-ribosyltransferase Diphtheria Toxin-like 1) and Sox2 (SRY (sex determining region Y)-box 2), which regulate reprogramming of cells. FGF4 regulates the development of stromal layers in both normal conditions and in acute myeloid leukemia. This gene is involved in spermatogenesis, and is up-regulated in testicular cancers. It has a protective action against adriamycin-induced testicular toxicity.

Caractéristiques et avantages

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST71534

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Toshiaki Yoshimoto et al.
Anticancer research, 38(1), 501-507 (2017-12-27)
We report the outcomes of sorafenib therapy for advanced hepatocellular carcinoma (HCC) in our Department. Thirty-eight patients with unresectable HCC who were administrated sorafenib from 2009 to 2015 were investigated retrospectively. The 1-year overall survival rate was 59.3%. The macroscopic
Boriana M Zaharieva et al.
The Journal of pathology, 201(4), 603-608 (2003-12-04)
Gene amplification is a common mechanism for oncogene overexpression. High-level amplifications at 11q13 have been repeatedly found in bladder cancer by comparative genomic hybridization (CGH) and other techniques. Putative candidate oncogenes located in this region are CCND1 (PRAD1, bcl-1), EMS1
Fabienne A Weber et al.
Stem cells (Dayton, Ohio), 31(11), 2364-2373 (2013-08-14)
The recently established reprogramming of somatic cells into induced pluripotent stem cells (iPSCs) by Takahashi and Yamanaka represents a valuable tool for future therapeutic applications. To date, the mechanisms underlying this process are still largely unknown. In particular, the mechanisms
C J Powers et al.
Endocrine-related cancer, 7(3), 165-197 (2000-10-06)
Fibroblast growth factors (FGFs) are small polypeptide growth factors, all of whom share in common certain structural characteristics, and most of whom bind heparin avidly. Many FGFs contain signal peptides for secretion and are secreted into the extracellular environment, where
A M Moon et al.
Development (Cambridge, England), 127(5), 989-996 (2000-02-09)
Fibroblast growth factors (FGFs) mediate multiple developmental signals in vertebrates. Several of these factors are expressed in limb bud structures that direct patterning of the limb. FGF4 is produced in the apical ectodermal ridge (AER) where it is hypothesized to

Articles

Glycosaminoglycans are large linear polysaccharides constructed of repeating disaccharide units.

Questions

Évaluations

Aucune valeur de notation

Filtres actifs

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique