Accéder au contenu
Merck
Toutes les photos(4)

Documents

HPA010817

Sigma-Aldrich

Anti-FXYD5 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonyme(s) :

Anti-Dysadherin, Anti-FXYD domain-containing ion transport regulator 5 precursor

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Numéro HPA (Human Protein Atlas):
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Gamme de produits

Prestige Antibodies® Powered by Atlas Antibodies

Forme

buffered aqueous glycerol solution

Espèces réactives

human

Validation améliorée

recombinant expression
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

Technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:20-1:50

Séquence immunogène

DTTSSSSADSTIMDIQVPTRAPDAVYTELQPTSPTPTWPADETPQPQTQTQQLEGTDGPLVTDPETHKSTKAAHPTDDTTTLSERPSPSTDVQTDPQTLKPSGFHEDDPFFYDEHTLR

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... FXYD5(53827)

Description générale

FXYD5 (FXYD domain containing ion transport regulator 5) is a cancer-associated glycoprotein localized to the cell surface. It belongs to the family of FXYD proteins, which interacts with and modulate Na,K-ATPase. These proteins span the cell membrane once. The cDNA for this gene codes for a protein of 178 amino acids, containing a single transmembrane domain, a short cytoplasmic tail. It also has a putative O-glycosylated extracellular region as well as a signal peptide. This gene is present with the human chromosome locus 19q13.12. Under normal conditions, it is expressed in only specific tissues. These are generally epithelial tissues such as, lung, kidney and intestine. It is also expressed in normal lymphocytes, as well as in stratified squamous epithelia, in the basal and endothelial cells.

Immunogène

FXYD domain-containing ion transport regulator 5 precursor recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Actions biochimiques/physiologiques

FXYD5 (FXYD domain containing ion transport regulator 5) is responsible for transcriptionally down-regulating E-cadherin. Therefore, it facilitates tumor invasiveness and metastasis. It is suggested that FXYD5 interacts with actin, and has a role in the formation of microvilli. It is expressed in a wide range of cancer, such as breast, stomach, pancreatic and colon. It is also expressed in head and neck squamous cell carcinoma. It is also expressed in testis, epididymis and ejaculated sperms. In the ejaculated spermatozoa, it co-localizes with E-cadherin and Na,K-ATPase, and therefore, might be a regulator of sperm function. FXYD5 might have potential to determine the prognosis of disease-free survival in stage I NSCLC patients. Its expression level correlates to the risk level of gastrointestinal stromal tumors (GISTs), and thus, may be used for the prognosis of GISTs.

Caractéristiques et avantages

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST71700

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Sergey B Akopov et al.
Mammalian genome : official journal of the International Mammalian Genome Society, 17(10), 1042-1049 (2006-10-05)
Identification of insulators is one of the most difficult problems in functional mapping of genomes. For this reason, up to now only a few insulators have been described. In this article we suggest an approach that allows direct isolation of
Yoshinori Ino et al.
Proceedings of the National Academy of Sciences of the United States of America, 99(1), 365-370 (2002-01-05)
We report the cloning and characterization of a cancer-associated cell membrane glycoprotein recognized by mAb NCC-3G10. The antibody showed strong reactivity to a wide variety of cancer cells, but only to a limited number of normal cells including lymphocytes, endothelial
Kenji Ono et al.
Anticancer research, 30(9), 3273-3278 (2010-10-15)
Adjuvant chemotherapy is required following the resection of aggressive NSCLC. It is therefore necessary to identify factors that accurately predict prognosis. Tumor specimens were collected from 107 patients who underwent a complete resection for NSCLC from 1994-2000 in this Department.
Alexandros Georgolios et al.
Medical oncology (Northwood, London, England), 29(3), 1463-1467 (2011-11-23)
Dysadherin is a cancer-related cell membrane glycoprotein, recently identified, playing an important role in tumor progression and metastasis. In the present minireview article, we are focusing on the role of dysadherin in E-cadherin downregulation, the various expression patterns of the
Patricia L Brazee et al.
Frontiers in immunology, 8, 623-623 (2017-06-18)
The alveolar epithelium secretes cytokines and chemokines that recruit immune cells to the lungs, which is essential for fighting infections but in excess can promote lung injury. Overexpression of FXYD5, a tissue-specific regulator of the Na,K-ATPase, in mice, impairs the

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique