Accéder au contenu
Merck
Toutes les photos(1)

Principaux documents

AV51676

Sigma-Aldrich

Anti-NUFIP2 antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-182-FIP, Anti-82-FIP, Anti-FIP-82, Anti-FLJ10976, Anti-KIAA1321, Anti-MGC117262, Anti-Nuclear fragile X mental retardation protein interacting protein 2, Anti-PIG1

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

100 μL
423,00 €

423,00 €


Date d'expédition estimée le25 avril 2025



Sélectionner une taille de conditionnement

Changer de vue
100 μL
423,00 €

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

423,00 €


Date d'expédition estimée le25 avril 2025


Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

76 kDa

Espèces réactives

human, dog, rat, bovine, mouse, horse, guinea pig, rabbit

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... NUFIP2(57532)

Immunogène

Synthetic peptide directed towards the N terminal region of human NUFIP2

Application

Anti-NUFIP2 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 μg/ml.

Actions biochimiques/physiologiques

Nuclear fragile X mental retardation protein interacting protein 2 (NUFIP2) is an RNA-binding protein involved in posttranslational regulation. It is found in association with actively translating polyribosomes, RNA granules in cytoplasm, RNA complexes in neurites and RNAi machinery.

Séquence

Synthetic peptide located within the following region: IPNGVVTNNSGYITNGYMGKGADNDGSGSESGYTTPKKRKARRNSAKGCE

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Andres Ramos et al.
Structure (London, England : 1993), 14(1), 21-31 (2006-01-13)
FMRP, whose lack of expression causes the X-linked fragile X syndrome, is a modular RNA binding protein thought to be involved in posttranslational regulation. We have solved the structure in solution of the N-terminal domain of FMRP (NDF), a functionally
Barbara Bardoni et al.
Human molecular genetics, 12(14), 1689-1698 (2003-07-03)
FMRP is an RNA binding protein whose absence produces pathological manifestations of the fragile-X syndrome. FMRP is a component of mRNP complexes found in association with actively translating polyribosomes, RNA complexes trafficking in neurites, RNA granules in cytoplasm and, in
Jingyue Jia et al.
The Journal of cell biology, 221(11) (2022-10-01)
We report that lysosomal damage is a hitherto unknown inducer of stress granule (SG) formation and that the process termed membrane atg8ylation coordinates SG formation with mTOR inactivation during lysosomal stress. SGs were induced by lysosome-damaging agents including SARS-CoV-2ORF3a, Mycobacterium

Questions

Évaluations

Aucune valeur de notation

Filtres actifs

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique