Accéder au contenu
Merck
Toutes les photos(2)

Documents

AV50240

Sigma-Aldrich

Anti-MOGAT1 antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-DGAT2L, Anti-DGAT2L1, Anti-MGAT1, Anti-Monoacylglycerol O-acyltransferase 1

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Numéro MDL:
Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

39 kDa

Espèces réactives

mouse, pig, human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... MOGAT1(116255)

Catégories apparentées

Immunogène

Synthetic peptide directed towards the C terminal region of human MOGAT1

Application

Anti-MOGAT1 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Actions biochimiques/physiologiques

Monoacylglycerol O-acyltransferase 1 (MOGAT1) catalyzes the synthesis of diacylglycerols that in turn act as precursors for the triacylglycerols and phospholipids. MOGAT enzymes are highly expressed in the liver; hepatic MOGAT1 is a potential therapeutic target for metabolic disorders such as obesity, steatosis and type 2 diabetes mellitus.

Séquence

Synthetic peptide located within the following region: PIPVRQTLNPTQEQIEELHQTYMEELRKLFEEHKGKYGIPEHETLVLK

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Angela M Hall et al.
Journal of lipid research, 53(5), 990-999 (2012-03-08)
Intrahepatic lipid accumulation is extremely common in obese subjects and is associated with the development of insulin resistance and diabetes. Hepatic diacylglycerol and triacylglycerol synthesis predominantly occurs through acylation of glycerol-3-phosphate. However, an alternative pathway for synthesizing diacylglycerol from monoacylglycerol
Yasuhiro Hayashi et al.
Molecular therapy. Nucleic acids, 3, e154-e154 (2014-03-20)
Over the past decade, considerable advances have been made in the discovery of gene targets in metabolic diseases. However, in vivo studies based on molecular biological technologies such as the generation of knockout mice and the construction of short hairpin

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique