Accéder au contenu
Merck
Toutes les photos(2)

Key Documents

AV49411

Sigma-Aldrich

Anti-HLA-F antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-CDA12, Anti-HLA-5.4, Anti-HLA-CDA12, Anti-HLAF, Anti-Major histocompatibility complex, class I, F

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(2)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

48 kDa

Espèces réactives

pig, human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunohistochemistry: suitable
western blot: suitable

Numéro d'accès NCBI

NP_061823

Numéro d'accès UniProt

P30511

Conditions d'expédition

wet ice

Température de stockage

−20°C

Informations sur le gène

human ... HLA-F(3134)

Catégories apparentées

Immunogène

Synthetic peptide directed towards the N terminal region of human HLA-F

Application

Anti-HLA-F antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Actions biochimiques/physiologiques

Major histocompatibility complex, class I, F (HLA-F) is a non-classic heavy chain that forms a heterodimer with β-2 microglobulin and participates in MHC-I antigen cross-presentation pathway. HLA-F functions as a ligand for Ig-like receptors on natural killer cells that regulate the inflammatory response.

Séquence

Synthetic peptide located within the following region: EAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADT

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Jodie P Goodridge et al.
Journal of immunology (Baltimore, Md. : 1950), 191(7), 3553-3562 (2013-09-11)
Killer Ig-like receptors (KIRs) are innate immune receptors expressed by NK and T cells classically associated with the detection of missing self through loss of their respective MHC ligand. Some KIR specificities for allelic classical class I MHC (MHC-I) have
Jodie P Goodridge et al.
Journal of immunology (Baltimore, Md. : 1950), 191(4), 1567-1577 (2013-07-16)
Peptides that are presented by MHC class I (MHC-I) are processed from two potential sources, as follows: newly synthesized endogenous proteins for direct presentation on the surface of most nucleated cells and exogenous proteins for cross-presentation typically by professional APCs.

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique