Accéder au contenu
Merck
Toutes les photos(2)

Documents

AV49163

Sigma-Aldrich

Anti-RABGGTA antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-Rab geranylgeranyltransferase, α subunit

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

65 kDa

Espèces réactives

human, rat, guinea pig, dog, bovine, mouse

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... RABGGTA(5875)

Immunogène

Synthetic peptide directed towards the N terminal region of human RABGGTA

Application

Anti-RABGGTA antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/ml.

Actions biochimiques/physiologiques

Rab geranylgeranyltransferase, alpha subunit (RABGGTA; PTAR3) an enzyme that attaches geranylgeranyl groups to Rab proteins. The activity of this enzyme is essential for hemostasis and platelet synthesis. Polymorphisms in RABGGTA gene have been observed in patients with Hermansky-Pudlak syndrome.

Séquence

Synthetic peptide located within the following region: ELAFTDSLITRNFSNYSSWHYRSCLLPQLHPQPDSGPQGRLPEDVLLKEL

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

W Li et al.
Molecular genetics and metabolism, 71(4), 599-608 (2001-01-04)
Hermansky-Pudlak syndrome (HPS) is a recessively inherited disease with dysfunction of several related subcellular organelles including platelet-dense granules, melanosomes, and lysosomes. Our recent identification of the mutation in murine Rab geranylgeranyl transferase alpha-subunit gene (Rabggta) in one mouse model of
J C Detter et al.
Proceedings of the National Academy of Sciences of the United States of America, 97(8), 4144-4149 (2000-03-29)
Few molecular events important to platelet biogenesis have been identified. Mice homozygous for the spontaneous, recessive mutation gunmetal (gm) have prolonged bleeding, thrombocytopenia, and reduced platelet alpha- and delta-granule contents. Here we show by positional cloning that gm results from

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique