AV48273
Anti-ALDOC antibody produced in rabbit
affinity isolated antibody
Synonyme(s) :
Anti-ALDC, Anti-Aldolase C, fructose-bisphosphate
Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
About This Item
Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41
Source biologique
rabbit
Niveau de qualité
Conjugué
unconjugated
Forme d'anticorps
affinity isolated antibody
Type de produit anticorps
primary antibodies
Clone
polyclonal
Forme
buffered aqueous solution
Poids mol.
39 kDa
Espèces réactives
dog, rat, human, bovine, horse, guinea pig, rabbit, mouse
Concentration
0.5 mg - 1 mg/mL
Technique(s)
western blot: suitable
Numéro d'accès NCBI
Numéro d'accès UniProt
Conditions d'expédition
wet ice
Température de stockage
−20°C
Modification post-traductionnelle de la cible
unmodified
Informations sur le gène
human ... ALDOC(230)
Catégories apparentées
Description générale
ALDOC codes for a class I fructose-biphosphate aldolase that catalyzes the breakdown of fructose-1,6-biphosphate to dihydroxyacetone phosphate (DHAP) and glyceraldehyde-3-phosphate during glycolysis. It also catalyzes the aldol cleavage of fructose-1 phosphate to DHAP and glyceraldehyde. ALDOC is expressed in the cerebellum, retina and other parts of the CNS. It is known to be upregulated in the brain and skeletal muscles cells of chickens during hypoxia.
Rabbit Anti-ALDOC antibody recognizes bovine, human, mouse, rat, zebrafish, and rabbit ALDOC.
Rabbit Anti-ALDOC antibody recognizes bovine, human, mouse, rat, zebrafish, and rabbit ALDOC.
Immunogène
Synthetic peptide directed towards the N terminal region of human ALDOC
Application
Rabbit Anti-ALDOC antibody is suitable for western blot applications at a concentration of 0.5 μg/ml.
Actions biochimiques/physiologiques
ALDOC gene is a member of the class I fructose-biphosphate aldolase gene family. ALDOC is a glycolytic enzyme that catalyzes the reversible aldol cleavage of fructose-1,6-biphosphate and fructose 1-phosphate to dihydroxyacetone phosphate and either glyceraldehyde-3-phosphate or glyceraldehyde, respectively.This gene encodes a member of the class I fructose-biphosphate aldolase gene family. Expressed specifically in the hippocampus and Purkinje cells of the brain, the encoded protein is a glycolytic enzyme that catalyzes the reversible aldol cleavage of fructose-1,6-biphosphate and fructose 1-phosphate to dihydroxyacetone phosphate and either glyceraldehyde-3-phosphate or glyceraldehyde, respectively.
Séquence
Synthetic peptide located within the following region: MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVE
Forme physique
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clause de non-responsabilité
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Outil de sélection de produits.
En option
Réf. du produit
Description
Tarif
Code de la classe de stockage
10 - Combustible liquids
Classe de danger pour l'eau (WGK)
WGK 3
Point d'éclair (°F)
Not applicable
Point d'éclair (°C)
Not applicable
Certificats d'analyse (COA)
Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".
Déjà en possession de ce produit ?
Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.
C F Wang et al.
Animal genetics, 38(3), 203-210 (2007-06-02)
Two sequence variants of the aldolase C (ALDOC) gene were discovered based on comparison of the sequences from an altiplano chicken breed (Tibetan chicken) and two lowland breeds (White Leghorn and ShouGuang). Gel-shift results indicated that one of these variants
Ryota Maruyama et al.
Pathology international, 72(3), 176-186 (2022-02-12)
Colorectal cancer (CRC) is a leading cause of cancer-related death worldwide. The spheroid colony formation assay is a useful method to identify cancer stem cells (CSCs). Using the DLD-1 and WiDr CRC cell lines, we performed microarray analyses of spheroid
Hirofumi Fujita et al.
PloS one, 9(1), e86679-e86679 (2014-01-30)
Aldolase C (Aldoc, also known as "zebrin II"), a brain type isozyme of a glycolysis enzyme, is expressed heterogeneously in subpopulations of cerebellar Purkinje cells (PCs) that are arranged longitudinally in a complex striped pattern in the cerebellar cortex, a
Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..
Contacter notre Service technique