Accéder au contenu
Merck
Toutes les photos(1)

Documents

AV46789

Sigma-Aldrich

Anti-LMAN2 (AB2) antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-C5orf8, Anti-GP36B, Anti-Lectin, mannose-binding 2, Anti-VIP36

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

40 kDa

Espèces réactives

mouse, dog, rat, human, bovine, horse, rabbit, guinea pig

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Informations sur le gène

human ... LMAN2(10960)

Immunogène

Synthetic peptide directed towards the C terminal region of human LMAN2

Application

Anti-LMAN2 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 0.25μg/mL.

Actions biochimiques/physiologiques

LMAN2 (Lectin, mannose-binding 2) gene encodes a type I transmembrane lectin protein localized in endoplasmic reticulum, the Golgi apparatus and the plasma membrane. It plays a pivotal role in sorting, trafficking and quality control of secretory proteins and/or lipids.

Séquence

Synthetic peptide located within the following region: LMVEHTPDEESIDWTKIEPSVNFLKSPKDNVDDPTGNFRSGPLTGWRVFL

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Daisuke Nawa et al.
Glycobiology, 17(9), 913-921 (2007-06-26)
VIP36 is an intracellular lectin that cycles between the endoplasmic reticulum (ER) and the Golgi apparatus, and is thought to act as a cargo receptor in the transport and sorting of glycoproteins. Here we sought to identify the proteins that

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique