Accéder au contenu
Merck
Toutes les photos(1)

Documents

AV45360

Sigma-Aldrich

Anti-PTPN1 antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-PTP1B, Anti-Protein tyrosine phosphatase, non-receptor type 1

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(1)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

50 kDa

Espèces réactives

horse, mouse, dog, bovine, rat, guinea pig, human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

NP_002818

Numéro d'accès UniProt

P18031

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... PTPN1(5770)

Catégories apparentées

Immunogène

Synthetic peptide directed towards the middle region of human PTPN1

Application

Anti-PTPN1 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/ml.

Actions biochimiques/physiologiques

Protein tyrosine phosphatase, non-receptor type 1 (PTPN1) is the first member of protein tyrosine phosphatase (PTP) family to be identified. The members of this family are involved in cell growth, differentiation and mitosis. PTPN1 dephosphorylates insulin receptor, JAK2 and TYK2 kinases and negatively regulates cell signaling mediated by these proteins.

Séquence

Synthetic peptide located within the following region: SGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVL

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

M P Myers et al.
The Journal of biological chemistry, 276(51), 47771-47774 (2001-11-06)
The reversible tyrosine phosphorylation of proteins, modulated by the coordinated actions of protein-tyrosine kinases and protein-tyrosine phosphatases (PTPs), regulates the cellular response to a wide variety of stimuli. It is established that protein kinases possess discrete sets of substrates and
Edyta E Wojtowicz et al.
Cell stem cell, 19(3), 383-396 (2016-07-19)
Umbilical cord blood (CB) is a convenient and broadly used source of hematopoietic stem cells (HSCs) for allogeneic stem cell transplantation. However, limiting numbers of HSCs remain a major constraint for its clinical application. Although one feasible option would be
Reza Meshkani et al.
Clinical chemistry, 53(9), 1585-1592 (2007-07-20)
Protein tyrosine phosphatase 1B (PTPN1) dephosphorylates insulin receptors and attenuates insulin signaling. Polymorphisms in the coding sequence of PTPN1 have been variably associated with type 2 diabetes (T2D). We hypothesized that variations within the PTPN1 promoter might contribute to the
Tony Tiganis et al.
The Biochemical journal, 402(1), 1-15 (2007-01-24)
It is now well established that the members of the PTP (protein tyrosine phosphatase) superfamily play critical roles in fundamental biological processes. Although there has been much progress in defining the function of PTPs, the task of identifying substrates for

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique