Accéder au contenu
Merck
Toutes les photos(1)

Documents

AV43692

Sigma-Aldrich

Anti-ABCB9 antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-ATP-binding cassette, sub-family B (MDR/TAP), member 9, Anti-EST122234, Anti-KIAA1520, Anti-TAPL

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(1)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

80 kDa

Espèces réactives

rat, bovine, dog, human, mouse

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

NP_982269

Numéro d'accès UniProt

Q9NP78

Conditions d'expédition

wet ice

Température de stockage

−20°C

Informations sur le gène

human ... ABCB9(23457)

Immunogène

Synthetic peptide directed towards the N terminal region of human ABCB9

Actions biochimiques/physiologiques

ABCB9 belongs to the ATP-binding cassette (ABC) transporters superfamily and is involved in transport of molecules across extra- and intra-cellular membranes. It is reportedly associated with the lysosomes at high levels in testes and moderate levels in brain and spinal cord.

Séquence

Synthetic peptide located within the following region: RLWKAVVVTLAFMSVDICVTTAIYVFSHLDRSLLEDIRHFNIFDSVLDLW

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

F Zhang et al.
The Journal of biological chemistry, 275(30), 23287-23294 (2000-04-05)
We have cloned full-length human and mouse cDNAs of ABCB9, which encodes a predicted multiple-spanning transmembrane domain and a nucleotide-binding domain with Walker motifs. It is therefore designated as a "half" ATP binding cassette (ABC) transporter. Northern analysis shows that
M Dean et al.
Genome research, 11(7), 1156-1166 (2001-07-04)
The ATP-binding cassette (ABC) transporter superfamily contains membrane proteins that translocate a variety of substrates across extra- and intra-cellular membranes. Genetic variation in these genes is the cause of or contributor to a wide variety of human disorders with Mendelian

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique