AV40681

Anti-SURF6 (AB2) antibody produced in rabbit

IgG fraction of antiserum

• Synonyme(s) : Anti-Surfeit 6
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: IgG fraction of antiserum
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 40 kDa
• Espèces réactives: human, horse
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): immunohistochemistry: suitable; western blot: suitable
• Numéro d'accès NCBI: NP_006744
• Numéro d'accès UniProt: O75683
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Informations sur le gène: human ... SURF6(6838)

Description

Description générale

The gene SURF6 (surfeit 6) encodes a member of the Surfeit locus that is found to be localized to the nucleolus. The encoded protein is a unique component of the nucleolar matrix system with no sequence similarity with any other known protein.

Immunogène

Synthetic peptide directed towards the middle region of human SURF6

Actions biochimiques/physiologiques

The gene SURF6 (surfeit 6) encodes a protein that has the ability to bind to nucleic-acids, with more affinity for RNA. It is found to be a structural protein that is present at all stages of the cell cycle in nucleolar substructures. It may be involved in the structure and functions of the nucleolar matrix by associating with nucleic acids. It may also be involved in rRNA (ribosomal RNA) processing.

Séquence

Synthetic peptide located within the following region: EPREPPGLIFNKVEVSEDEPASKAQRRKEKRQRVKGNLTPLTGRNYRQLL

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable