Accéder au contenu
Merck
Toutes les photos(2)

Documents

AV40475

Sigma-Aldrich

Anti-PRKRA antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-Protein kinase, interferon-inducible double stranded RNA-dependent activator

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

34 kDa

Espèces réactives

guinea pig, human, rat, rabbit, horse, mouse, dog, bovine

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunohistochemistry: suitable
western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... PRKRA(8575)

Description générale

Protein kinase, interferon-inducible double stranded RNA-dependent activator/protein activator of the interferon-induced protein kinase (PRKRA, PACT) is a stress-modulated cellular activator of interferon (IFN)-induced double-stranded (ds) RNA-activated protein kinase (PKR) which is involved in antiviral defense in mammals. PACT and Mammalian Dicer interacts with double-stranded RNA-binding protein (TRBP) and associate with Dicer to stimulate cleavage of double-stranded RNA found in short hairpin and short interfering RNA (siRNA).

Spécificité

Anti-PRKRA polyclonal antibody reacts with bovine, canine, human, mouse, and rat protein kinase, interferon-inducible double stranded RNA-dependent activators/protein activator of the interferon-induced protein kinases.

Immunogène

Synthetic peptide directed towards the middle region of human PRKRA

Application

Anti-PRKRA polyclonal antibody is used to tag protein kinase, interferon-inducible double stranded RNA-dependent activator/protein activator of the interferon-induced protein kinase for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of protein activator of the interferon-induced protein kinase (PACT) in stress response, antiviral activity and double-stranded RNA processing.

Actions biochimiques/physiologiques

PRKRA contains 3 DRBM (double-stranded RNA-binding) domains. It appears to have a pro-apoptotic function that may be suppressed in the presence of growth factor and activates EIF2AK2 in absence of double stranded RNA (dsRNA).

Séquence

Synthetic peptide located within the following region: RLPEYTLSQEGGPAHKREYTTICRLESFMETGKGASKKQAKRNAAEKFLA

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique