Accéder au contenu
Merck
Toutes les photos(1)

Principaux documents

AV39337

Sigma-Aldrich

Anti-ZFP64 (AB1) antibody produced in rabbit

IgG fraction of antiserum

Synonyme(s) :

Anti-Zinc finger protein 64 homolog (mouse)

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

100 μL
287,00 €

287,00 €


Check Cart for Availability
Un anticorps recombinant, sans conservateur, est disponible pour votre cible. Essayez ZRB1199


Sélectionner une taille de conditionnement

Changer de vue
100 μL
287,00 €

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

287,00 €


Check Cart for Availability
Un anticorps recombinant, sans conservateur, est disponible pour votre cible. Essayez ZRB1199

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

69 kDa

Espèces réactives

human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... ZFP64(55734)

Description générale

ZFP64 is a zinc-finger protein that enhances p65 stimulation and thereby promotes TLR-induced production of pro-inflammatory cytokines and type I interferons in macrophages.
Rabbit Anti-ZFP64 antibody recognizes bovine, canine, human, and pig ZFP64.

Immunogène

Synthetic peptide directed towards the N terminal region of human ZFP64

Application

Rabbit Anti-ZFP64 antibody is suitable for western blotting applications at a concentration of 2.5 μg/ml.

Actions biochimiques/physiologiques

ZFP64 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 9 C2H2-type zinc fingers and may be involved in transcriptional regulation.

Séquence

Synthetic peptide located within the following region: MNASSEGESFAGSVQIPGGTTVLVELTPDIHICGICKQQFNNLDAFVAHK

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Chunmei Wang et al.
The Journal of biological chemistry, 288(34), 24600-24608 (2013-07-17)
The molecular mechanisms that fine-tune the Toll-like receptor (TLR)-triggered innate immune response need further investigation. As an important transcription factor, zinc finger proteins (ZFPs) play important roles in many cell functions, including development, differentiation, tumorigenesis, and functions of the immune

Questions

Évaluations

Aucune valeur de notation

Filtres actifs

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique