Accéder au contenu
Merck
Toutes les photos(1)

Principaux documents

AV36364

Sigma-Aldrich

Anti-CHD1L antibody produced in rabbit

IgG fraction of antiserum

Synonyme(s) :

Anti-Chromodomain helicase DNA binding protein 1-like

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

100 μL
287,00 €

287,00 €


Date d'expédition estimée le30 mars 2025



Sélectionner une taille de conditionnement

Changer de vue
100 μL
287,00 €

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41
Conjugué:
unconjugated
application:
WB
Clone:
polyclonal
Espèces réactives:
mouse, rat, human, rabbit, pig
citations:
3
Technique(s):
western blot: suitable

287,00 €


Date d'expédition estimée le30 mars 2025


Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

45 kDa

Espèces réactives

mouse, rat, human, rabbit, pig

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... CHD1L(9557)

Immunogène

Synthetic peptide directed towards the middle region of human CHD1L

Actions biochimiques/physiologiques

Chromodomain helicase DNA binding protein 1-like (CHD1L) is a DNA helicase and chromatin remodeling factor that is important in DNA repair. It converts ATP to poly (ADP-ribose) and regulates the chromatin relaxation during DNA repair. It has been identified as an oncogene that induces cell proliferation, apoptosis inhibition, G1/S phase transition and embryo development. CHD1L acts as a marker for prognosis of solid tumors such as hepatocellular carcinoma.[1]

Séquence

Synthetic peptide located within the following region: DALPAAEGGSRDQEEGKNHMYLFEGKDYSKEPSKEDRKSFEQLVNLQKTL

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Jiyeon Hyeon et al.
Korean journal of pathology, 47(1), 9-15 (2013-03-14)
The gene for chromodomain helicase/ATPase DNA binding protein 1-like (CHD1L) was recently identified as a target oncogene within the 1q21 amplicon, which occurs in 46% to 86% of primary hepatocellular carcinoma (HCC) cases. However, the prognostic significance of CHD1L in
Wen Cheng et al.
Molecular cancer, 12(1), 170-170 (2013-12-24)
Comprehensive sequencing efforts have revealed the genomic landscapes of common forms of human cancer and  - 140 driver genes have been identified, but not all of them have been extensively investigated. CHD1L (chromodomain helicase/ATPase DNA binding protein 1-like gene) or
Alyssa C Snider et al.
Biology open, 2(2), 121-131 (2013-02-23)
During preimplantation development, the embryo must establish totipotency and enact the earliest differentiation choices, processes that involve extensive chromatin modification. To identify novel developmental regulators, we screened for genes that are preferentially transcribed in the pluripotent inner cell mass (ICM)

Questions

Évaluations

Aucune valeur de notation

Filtres actifs

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique