Accéder au contenu
Merck
Toutes les photos(2)

Principaux documents

AV31366

Sigma-Aldrich

Anti-ATF1 (AB2) antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-Activating transcription factor 1, Anti-EWS-ATF1, Anti-FUS/ATF-1, Anti-TREB36

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

100 μL
374,00 €

374,00 €


Date d'expédition estimée le14 mai 2025



Sélectionner une taille de conditionnement

Changer de vue
100 μL
374,00 €

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

374,00 €


Date d'expédition estimée le14 mai 2025


Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

29 kDa

Espèces réactives

rabbit, horse, dog, rat, guinea pig, human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunohistochemistry: suitable
western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... ATF1(466)

Description générale

ATF1 is a member of the AMP response element-binding protein/activating transcription factor (CREB/ATF) that associates with BRCA1. ATF1 target genes have been implicated in mediating transcriptional response to DNA damage. Moreover, studies have reported that phosphorylation of ATF1 is needed for growth factor-induced expression of c-jun.
Rabbit Anti-ATF1 (AB2) antibody recognizes rat, mouse, zebrafish, bovine, and human ATF1.

Immunogène

Synthetic peptide directed towards the middle region of human ATF1

Application

Rabbit Anti-ATF1 (AB2) antibody can be used for western blotting (0.5μg/ml) applications.

Actions biochimiques/physiologiques

ATF1 binds the cAMP response element (CRE) (consensus: 5′-GTGACGT [AC] [AG]-3′), a sequence present in many viral and cellular promoters. ATF1 binds to the Tax-responsive element (TRE) of HTLV-I. ATF1 mediates PKA-induced stimulation of CRE-reporter genes.

Séquence

Synthetic peptide located within the following region: YQIRTTPSATSLPQTVVMTSPVTLTSQTTKTDDPQLKREIRLMKNREAAR

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Pankaj Gupta et al.
The Journal of biological chemistry, 277(52), 50550-50556 (2002-11-05)
Epidermal growth factor induction of c-jun expression requires ATF1 and MEF2 sites in the c-jun promoter. We find that activation of the c-jun promoter through the ATF1 site requires phosphorylation of ATF1 at serine 63. A serine 63 to alanine
Y Houvras et al.
The Journal of biological chemistry, 275(46), 36230-36237 (2000-08-18)
BRCA1, a breast and ovarian cancer susceptibility gene, encodes a 220-kDa protein whose precise biochemical function remains unclear. BRCA1 contains an N-terminal RING finger that mediates protein-protein interaction. The C-terminal domain of BRCA1 (BRCT) can activate transcription and interacts with

Questions

Évaluations

Aucune valeur de notation

Filtres actifs

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique