Accéder au contenu
Merck
Toutes les photos(1)

Documents

AV30042

Sigma-Aldrich

Anti-KLF11 antibody produced in rabbit

IgG fraction of antiserum

Synonyme(s) :

Anti-Kruppel-like factor 11

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(1)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

55 kDa

Espèces réactives

human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

NP_003588

Numéro d'accès UniProt

O14901

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... KLF11(8462)

Immunogène

Synthetic peptide directed towards the N terminal region of human KLF11

Application

Anti-KLF11 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25 μg/ml.

Actions biochimiques/physiologiques

KLF11 belongs to KLF family of transcription factors that regulate GC promoters and important metabolic processes in diverse organisms. The histone acetyltransferase pathways mediated by KLF11 affect the regulation of insulin in neonatal diabetes. KLF11 mediates increase in basal insulin levels and glucose-stimulated insulin secretion. It suppresses inflammatory activation of endothelial cells by inhibition of NF-κB pathway that results in downregulation of VCAM-1 and E-selectin promoters.

Séquence

Synthetic peptide located within the following region: SQKGDLLRIRPLTPVSDSGDVTTTVHMDAATPELPKDFHSLSTLCITPPQ

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Gwen Lomberk et al.
The Journal of biological chemistry, 288(24), 17745-17758 (2013-04-17)
The function of Krüppel-like factor 11 (KLF11) in the regulation of metabolic pathways is conserved from flies to human. Alterations in KLF11 function result in maturity onset diabetes of the young 7 (MODY7) and neonatal diabetes; however, the mechanisms underlying
Yanbo Fan et al.
Arteriosclerosis, thrombosis, and vascular biology, 32(12), 2981-2988 (2012-10-09)
Endothelial cell (EC) inflammatory status is critical to many vascular diseases. Emerging data demonstrate that mutations of Krüppel-like factor-11 (KLF11), a gene coding maturity-onset diabetes mellitus of the young type 7 (MODY7), contribute to the development of neonatal diabetes mellitus.

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique