AV30038

Anti-SUPT3H antibody produced in rabbit

IgG fraction of antiserum

• Synonyme(s) : Anti-Suppressor of Ty 3 homolog (S. cerevisiae)
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: IgG fraction of antiserum
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 36 kDa
• Espèces réactives: human, dog, horse, pig, goat, bovine
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): immunohistochemistry: suitable; western blot: suitable
• Numéro d'accès NCBI: NP_003590
• Numéro d'accès UniProt: O75486
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Informations sur le gène: human ... SUPT3H(8464)

Description

Immunogène

Synthetic peptide directed towards the N terminal region of human SUPT3H

Application

Anti- SUPT3H antibody produced in rabbit is suitable for western blotting at a concentration of 0.4 μg/ml. For immunohistochemistry of paraffin-embedded tissue sections, a concentration of 4-8 μg/ml is suitable.

Actions biochimiques/physiologiques

Suppressor of Ty 3 homolog is a Saccharomyces cerevisiae transcription factor that regulates the transcription of RNA polymerase II-transcribed genes.[1]

Séquence

Synthetic peptide located within the following region: MRKDKKKLRRLLKYMFIRDYKSKIVKGIDEDDLLEDKLSGSNNANKRQKI

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable